Identifiers and Description

Gene Model Identifier

TTHERM_00227770

Standard Name

None

Aliases

PreTt12587 | 19.m00379

Description

translation initiation factor eIF-5A family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00467 ) KOW motif
  • ( PF05523 ) WxcM-like, C-terminal
  • ( TIGR00038 ) translation elongation factor P
  • ( TIGR00037 ) translation initiation factor eIF-5A
  • ( PF01287 ) Eukaryotic initiation factor 5A hypusine,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00227770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05485.19.997751616309157e-110translation initiation factor
eIF-5A family protein (161 aa)
SGDYJR047C9.999353957415832e-59ANB1 Translation elongation fa
ctor eIF-5A, previously though
t to function in translation i
nitiation; similar to and func
tionally redundant with Hyp2p;
undergoes an essential hypusi
nation modification; expressed
under anaerobic conditions
DictyBaseDDB_G02848617.998505003885351e-50eif5a on chromosome: 4 positio
n 2766075 to 2766554
WormBaseWBGene000020648.003782782428492e-46locus:iff-1 Eukaryotic trans
lation initiation factor 5A-1
status:Confirmed UniProt:P
34563 protein_id:CAA81597.2
OxytrichaContig1970.0.g235.998886722426197e-42Eukaryotic elongation factor 5
A hypusine, DNA-binding OB fol
d
Stentor CoeruleusSteCoe_81561.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00227770(coding)
ATGGAAAACAAAGATTAAATATAAAAGAATATAAATTTTGTTTGGAAAGAGTTTTAAGAA
TAGCAGAGAGGCATTAAGCAGGTATAAACAAAATTAAACTAAAAAGAAAAGTTAAATTAA
AATTAAAAAAGAAAAGAAAAAGAAATTAAAATGTCTGAAGAAGAAAATTTCGAACAAGGT
GAATCCGGCTCTTCCCACACCTACCCCATGCAAGCCGGTAACGTTAAGAAGAACGCTTAC
GCCATGCTTAGAGGTTTCCCTTGCAAGGTCGTCGAAATGACCACCTCCAAGGCCGGTAAG
CACGGTCACGCTAAGGCCACCATCGTCGGTGTCGATATTTTCACCGGTAAGAAGTACGAA
GATTCTTGCCCCACCTCCCACAATATGGAAATTCCCTTCGTCAAGAAGAACGAATACTAA
TTGATCGATATCGCTGATGACGGTTACGTTACCCTCTTACTCGATAACGGTGAAACCAAG
GAAGACCTTAAGCTCCCTGAAGACGAACCCGAATTAGTTGAAAAGTTAAGAGCTGACTTC
TCTGCTGAAAAGGATATCCTCGTCTCTGTCATCTCTGCTATGGGTCAAGAAAAGATCATC
TCCTACAGAGAAACCAGTGGTGCTAAGTCTTGA


>TTHERM_00227770(protein)
MENKDQIQKNINFVWKEFQEQQRGIKQVQTKLNQKEKLNQNQKRKEKEIKMSEEENFEQG
ESGSSHTYPMQAGNVKKNAYAMLRGFPCKVVEMTTSKAGKHGHAKATIVGVDIFTGKKYE
DSCPTSHNMEIPFVKKNEYQLIDIADDGYVTLLLDNGETKEDLKLPEDEPELVEKLRADF
SAEKDILVSVISAMGQEKIISYRETSGAKS


>TTHERM_00227770(gene)
ATGGAAAACAAAGATTAAATATAAAAGAATATAAATTTTGTTTGGAAAGAGTTTTAAGAA
TAGCAGAGAGGCATTAAGCAGGTATAAACAAAATTAAACTAAAAAGAAAAGTTAAATTAA
AATTAAAAAAGAAAAGAAAAAGAAATTAAAATGTCTGAAGAAGAAAATTTCGAACAAGGT
GAATCCGGCTCTTCCCACACCTACCCCATGCAAGCCGGTAACGTTAAGAAGAACGCTTAC
GCCATGCTTAGAGGTTTCCCTTGCAAGGTCGTCGAAATGACCACCTCCAAGGCCGGTAAG
CACGGTCACGCTAAGGCCACCATCGTCGGTGTCGATATTTTCACCGGTAAGAAGTACGAA
GATTCTTGCCCCACCTCCCACAATATGGAAATTCCCTTCGTCAAGAAGAACGAATACTAA
TTGATCGATATCGCTGATGACGGTTACGTTACCCTCTTACTCGATAACGGTGAAACCAAG
GAAGACCTTAAGCTCCCTGAAGACGAACCCGAATTAGTTGAAAAGTTAAGAGCTGACTTC
TCTGCTGAAAAGGATATCCTCGTCTCTGTCATCTCTGCTATGGGTCAAGAAAAGATCATC
TCCTACAGAGAAACCAGTGGTGCTAAGTCTTGA