Identifiers and Description

Gene Model Identifier

TTHERM_00225770

Standard Name

STF1 (Solute Transport Facilitator 1 )

Aliases

PreTt12487 | 19.m00279

Description

major facilitator superfamily protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00887 ) phosphate:H+ symporter
  • ( TIGR00898 ) cation transport protein
  • ( TIGR02332 ) 4-hydroxyphenylacetate permease
  • ( PF02295 ) Adenosine deaminase z-alpha domain
  • ( PF07690 ) transporter, major facilitator family
  • ( PF00083 ) transporter, major facilitator superfamily
  • ( TIGR00879 ) MFS transporter, sugar porter (SP)
  • ( TIGR00891 ) MFS transporter, sialate:H+ symporter (SHS)
  • ( TIGR00895 ) MFS transporter, aromatic acid:H+ symporter
  • ( TIGR00883 ) MFS transporter, metabolite:H+ symporter (MHS)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00225770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05968.19.997093137033517e-262hypothetical protein (532 aa)
WormBaseWBGene000089239.997019043202629e-21status:Confirmed UniProt:G5E
C34 protein_id:CAC35887.1
OxytrichaContig21106.0.g192.0004286606204839e-16Major Facilitator Superfamily
Stentor CoeruleusSteCoe_370530.0000000000002543665647376923
DictyBaseDDB_G02782610.0000000000010000211161514907DDB_G0278261 on chromosome: 3
position 577308 to 579437
SGDYDL194W0.0000029996948234116693SNF3 Plasma membrane low gluco
se sensor that regulates gluco
se transport; contains 12 pred
icted transmembrane segments a
nd a long C-terminal tail requ
ired for induction of hexose t
ransporters; also senses fruct
ose and mannose; similar to Rg
t2p

General Information

Paragraph NoGene NameParagraph Text
24STF1Solute Transport Facilitator 1 (STF1) is a protein from the major facilitator superfamily (MFS), one of the largest families of membrane transports known, found in archaea, bacteria, and eukaryotes. This protein is predicted to have a MFS1 domain (E-value 1e-08), and is likely to transport small solutes through the membrane through either uniport, symport, or antiport. Paragraph by: Lisette Espinosa and Charles McGregor (undergraduates), Keck Science Department, Claremont McKenna College

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00225770(coding)
ATGAGTTAAAATAATAATGTATAAGACAAAGGTGATGATGATAACGTCTCCGATTTAGAA
AAAAAGACTTTAGATGAAAATTTAGATATGGATTAATGTTTGGAATATGTGAATCCAAAA
GGAAAATACTAGCTCATATTGTTTTCAATTTTACTTTTATAAGGCATAGTAGGATCATTT
GTATTTGTTGGAGGTCCTTATTTTTTTTAAGATCCTATTTTTATTTGTTAAGATGGATCA
ACATGTAGTTAAGAAGATGCTTGTAAATAAGGAAACTACTCAATTTCCGATAGCAGTAAC
CATACTCTAACTCTCCAGTTTGATCTATATTGCGATAGATAGTATCTCAAAAATTTAAGT
CTTAGCTTTATTTTTATTGGTTCTCTTTGTGGGACGTTCTTTTTTAGTTTTCTGAGTGAT
TTAAAAGGAAGAAAATTGCCTATGATAATATCATGGGCTTTTAGCGTTTTGGGTATTGGA
ATATTAGCTTTTTCTCAAAATTATGCTATGATTTTTGTAGGTTAGTTTTTAGGTGGATTC
GGAATCTATCCAACGAGCACTTTGGCTTTTATCGTTATGAGTGAATAATCAACAGGTAAT
TTTAGAAAGGTAGCTACAGGATATTTATTATTAGGCTATACACTTAGTGAGGGATCAATC
AATTTGCTAGGTTTTCTTTTTAACAACGATTGGAAGATTTTAATTAGATATTGGTTATTT
ATTCCTTCCATTATTTTGTGGTTTCCACTCTTTTATTTAATTGAAAGCCCAAGATTTTAT
CTAAATAAAGATAAGGAAAAAGTCTTAGATTGTTTGAACAAAATTGGAGCTAGAAACACT
AAAAAATCATACTAAGCAGCTCCGTTGCAGTTAACTAAAGAATAAATTAATTTCCATAAG
TACTCACTAATTAAGAAGAAAGAAGTTTATTCTTATTTAACCCTCTTTAAGTATAAATCA
ACTAGGTGGATTACAATTGCTTGCTCTATATAAAAGTTTTTAATGATATTTGTTAATTAT
GGTACTTAGTTCTCTCTATCTGATTTTGGCTTTAATATTTACATTAATGCAACCATAGGA
TTCTTGGCTGAGATGGTTTGCTTTGGATTCTTAGTCAAAGTTTTGAATACCTTCAAAAGA
AAACCTTCTGCTTTGTTCTTTTAGATTTTGAGTAGCATTTTCTGCTTGCTATTTATTGCT
TTTCCTATCCCAGACTCCTGCAAAAATAGCAGCTGCTATCAGAAATATGTATAAATCTTG
CTCTTTTTACTTTCTAAAATGTCGATTAACTCCTACTTTGTTGTCATAAGTACTTATTTC
CCTGAATTATACCCAACTTCTGTCAGGAGCTTAGGTGTAGGTTTTATCAGAGCAACTGGA
ATCTCAGGAAGTATTCTATCTTCCTTCGCCATAAGCTGGAGTAAAGAATTGGGAATATCT
CCTCTTGTTTCTTTTGGTATTATTGGTAGTTTTGGAATTATTTTTGGATTCTATCTACCT
GAAACATAAAATCAACCATTACAAGATGAAATAATAGAAATTAAGCATCAGAAAAATTCT
CTATTAGAAGTAGATGCATATTAAGCAGTTTCAAAAATAAGTGATACTTATAACAATTAA
CTTAGTAATTAAAGTGATGATTGA


>TTHERM_00225770(protein)
MSQNNNVQDKGDDDNVSDLEKKTLDENLDMDQCLEYVNPKGKYQLILFSILLLQGIVGSF
VFVGGPYFFQDPIFICQDGSTCSQEDACKQGNYSISDSSNHTLTLQFDLYCDRQYLKNLS
LSFIFIGSLCGTFFFSFLSDLKGRKLPMIISWAFSVLGIGILAFSQNYAMIFVGQFLGGF
GIYPTSTLAFIVMSEQSTGNFRKVATGYLLLGYTLSEGSINLLGFLFNNDWKILIRYWLF
IPSIILWFPLFYLIESPRFYLNKDKEKVLDCLNKIGARNTKKSYQAAPLQLTKEQINFHK
YSLIKKKEVYSYLTLFKYKSTRWITIACSIQKFLMIFVNYGTQFSLSDFGFNIYINATIG
FLAEMVCFGFLVKVLNTFKRKPSALFFQILSSIFCLLFIAFPIPDSCKNSSCYQKYVQIL
LFLLSKMSINSYFVVISTYFPELYPTSVRSLGVGFIRATGISGSILSSFAISWSKELGIS
PLVSFGIIGSFGIIFGFYLPETQNQPLQDEIIEIKHQKNSLLEVDAYQAVSKISDTYNNQ
LSNQSDD


>TTHERM_00225770(gene)
ATGAGTTAAAATAATAATGTATAAGACAAAGGTGATGATGATAACGTCTCCGATTTAGAA
AAAAAGACTTTAGATGAAAATTTAGATATGGATTAATGTTTGGAATATGTGAATCCAAAA
GGAAAATACTAGCTCATATTGTTTTCAATTTTACTTTTATAAGGCATAGTAGGATCATTT
GTATTTGTTGGAGGTCCTTATTTTTTTTAAGATCCTATTTTTATTTGTTAAGATGGATCA
ACATGTAGTTAAGAAGATGCTTGTAAATAAGGAAACTACTCAATTTCCGATAGCAGTAAC
CATACTCTAACTCTCCAGTTTGATCTATATTGCGATAGATAGTATCTCAAAAATTTAAGT
CTTAGCTTTATTTTTATTGGTTCTCTTTGTGGGACGTTCTTTTTTAGTTTTCTGAGTGAT
TTAAAAGGAAGAAAATTGCCTATGATAATATCATGGGCTTTTAGCGTTTTGGGTATTGGA
ATATTAGCTTTTTCTCAAAATTATGCTATGATTTTTGTAGGTTAGTTTTTAGGTGGATTC
GGAATCTATCCAACGAGCACTTTGGCTTTTATCGTTATGAGTGAATAATCAACAGGTAAT
TTTAGAAAGGTAGCTACAGGATATTTATTATTAGGCTATACACTTAGTGAGGGATCAATC
AATTTGCTAGGTTTTCTTTTTAACAACGATTGGAAGATTTTAATTAGATATTGGTTATTT
ATTCCTTCCATTATTTTGTGGTTTCCACTCTTTTATTTAATTGAAAGCCCAAGATTTTAT
CTAAATAAAGATAAGGAAAAAGTCTTAGATTGTTTGAACAAAATTGGAGCTAGAAACACT
AAAAAATCATACTAAGCAGCTCCGTTGCAGTTAACTAAAGAATAAATTAATTTCCATAAG
TACTCACTAATTAAGAAGAAAGAAGTTTATTCTTATTTAACCCTCTTTAAGTATAAATCA
ACTAGGTGGATTACAATTGCTTGCTCTATATAAAAGTTTTTAATGATATTTGTTAATTAT
GGTACTTAGTTCTCTCTATCTGATTTTGGCTTTAATATTTACATTAATGCAACCATAGGA
TTCTTGGCTGAGATGGTTTGCTTTGGATTCTTAGTCAAAGTTTTGAATACCTTCAAAAGA
AAACCTTCTGCTTTGTTCTTTTAGATTTTGAGTAGCATTTTCTGCTTGCTATTTATTGCT
TTTCCTATCCCAGACTCCTGCAAAAATAGCAGCTGCTATCAGAAATATGTATAAATCTTG
CTCTTTTTACTTTCTAAAATGTCGATTAACTCCTACTTTGTTGTCATAAGTACTTATTTC
CCTGAATTATACCCAACTTCTGTCAGGAGCTTAGGTGTAGGTTTTATCAGAGCAACTGGA
ATCTCAGGAAGTATTCTATCTTCCTTCGCCATAAGCTGGAGTAAAGAATTGGGAATATCT
CCTCTTGTTTCTTTTGGTATTATTGGTAGTTTTGGAATTATTTTTGGATTCTATCTACCT
GAAACATAAAATCAACCATTACAAGATGAAATAATAGAAATTAAGCATCAGAAAAATTCT
CTATTAGAAGTAGATGCATATTAAGCAGTTTCAAAAATAAGTGATACTTATAACAATTAA
CTTAGTAATTAAAGTGATGATTGA