Identifiers and Description

Gene Model Identifier

TTHERM_00225630

Standard Name

SCC3 (Sister Chromatid Cohesion 3)

Aliases

PreTt12473 | 19.m00265

Description

HEAT repeat protein associated with the kleisin subunit of the cohesin complex.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02985 ) HEAT repeat
  • ( PF08514 ) STAG domain
  • ( PF06732 ) Pescadillo N-terminus
  • ( PF04764 ) Protein of unknown function (DUF613)
  • ( PF08385 ) Dynein heavy chain, N-terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00225630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05536.19.997093137033517e-262hypothetical protein (932 aa)
WormBaseWBGene000068200.0000007997233352734267locus:unc-89 Muscle M-line a
ssembly protein unc-89 statu
s:Partially_confirmed UniPro
t:O01761 protein_id:CCD63865
.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23555314: Howard-Till RA, Lukaszewicz A, Novatchkova M, Loidl J (2013) A single cohesin complex performs mitotic and meiotic functions in the protist tetrahymena. PLoS genetics 9(3):e1003418

Sequences

>TTHERM_00225630(coding)
ATGCCTCCTAAAAAATCTGGATAAAGCAGGGGAAACCAGCGTTAGGCAAACTAATAAAAA
TCAAAGCCAATTTCAGAGTATACTGATTATAATTTATATGAGTAATTATCAAGAGAAAAT
TGTTCGATTGAAGAGATTTTAGATCAAATAAAAGATGTAGATGATTAAGAAACAAAAGAG
AATATCCTATAAAACTTTGTTCAGTTGATTTTTAAACTAGTAGGACTCAATAGTTTTGTG
ATAAAATTAGAAGACAAATAATTTTCTTCTATTGATTAGGATTTTTTCAAATCAGAAATA
GAATCTAATTTAAAAAATGTTAAGGATTTTAATTGGGTTTTTACTACAAGAAAAGAAGAG
CACTAGTTCCTCAAAGACAATCTCTTTATTTTCTTTGACTCAATTTTATAGCAAAGTCAA
TATTACAAATCAGAAAAAAAGGATGATTCTTTTATGGTAAATCTCTCTAATTTCCTAATT
ATGTTATCAAAATCCCATATTTAGAATGTAAGATAGAATGTATTGAGATTAGTAAGGATT
ATAGTTGAGTAGGGCTTGATTAGAATAGAGAAATTGAGGGCTGCTTAATAGAGAAAATTA
TAGAAAGAAGAGCAATATTTAAAAAACATTCTTGAAAACATTATGAATATATTGATTAAA
GGTATTTTCCATAGTAGAATTTTAGATAAGAGTCAGTCAATATAGCAAGATTGTATTGAA
TCTTTTGAGATTTTCTTTAATATTTCTCCTTAAATGACTTTGAATTCTTAGAATCTCATT
TAATTGTGTTATTTATTTGATTCTGATATTGATCTCGCTAATGCACTCTTAAAAGTACTT
ATCAATATAAAATGGAAAGAAACAGAGTCATCTTTGGAGGCTCTTAAAGAGTTAGTTCAA
TATGATAAATTCAGGAAGAGATTAATTTATTTTTCTAACATTTCAACATTTGTCACAAGT
TACAGAGCTATTCAATTAGTTAACCTGATAGATGAAATTCTACCTGGATCACTCAACAAC
AAAGACTTAAAAAGAGCAATGGCAACTATCTTCCATAAATATGAAGAAGTCAGAGCAGAG
GGATTTAAGATTCTTTAAAAATTTTTAGAAGTTAATGAGGGTGAAAGATAAATTAGCGTC
ATAAATCTCGAAGGAGGCGAAGACGATGGTGTTAGCGATATTTTCTAGTTCAAATAATAA
ACCAATTCTTTAGCCTGTTAAACTTTTATAAAGAAATTTTATACACTTTTGGATGAAGTG
GATTCCAAAATTTATGAAAAAGAAGATTTGATCTAAAATATGATAAATTCTCTTGGTTTT
GAATTTGGTGCTATTTACGATTTCCAAAATATTTTCCAATTGCTAAATTAGTTACCATCA
TCGAATTTAAAAGATAAAATTTTTGATTTGTTTAAATTGATTGTTATAATTTTGAAAAAA
ACGATGAAATTCTTATAGCTAATATCGTAAGGCGAGAATCCATCGAGCATTTACAACCAA
AAGCAATCAGAAAAGTTGCTTATCATTAGAAATGAATTCTTTAAAGCCTTGGTGGCTAAT
TTTGATAACTTTTATGAGAATATGAATAAACACCCTATCTTAAAAGAGTATTCTTACCAA
TTATTGCTATCAATTCCAGCTATAGACCTCCAACAGAATTTAAAAGAAACCTAGTTCAAA
ACAATATCAAAGAAAATAGCTGAAGACATACTAAATACAATACTAAACTAAGATTCTTTC
ATTGAAGATAAATCTTAATCTATGGGACTTGTTTTTGGATGCGTTAGCACCCTTTAATAC
TTCCTCTTACACACCCCAAGGGCCTACATCGATCCTTTTAAATAATGCAAGGAGAAATTG
ATTAAACATGCGATTTTAGATTGTACTGACAATTTACATGAAATAGTAGTTCAAGAAAAG
GAGACGTCTTTAGATTTGTCTTAGCTGTAAGAAGAATATACTTATTTGTTTATTAAATTG
TTTAGCTGCACCAATCTCTTAAATTAATTGGATGAAATATATTGTGAAAGTTTTATATAA
AAGTGCTTAGAAATCACTGATACAGCTACTTCATATACTTCAACTGACAACACTTGCATT
TATACTTTTACTAGTTTAGGGTTACAATTAGACTTTTACTTGAACGTATTGAGAGTTGGA
TTGTCTGAATCTTGCTAAAAAACTTCAAGACTTGAAGAGTATCTTAAGTATAGGTAAAAA
GTTATCAAATAGCTCTGGCTCTTCCTTAGAGAAGAGAAGAAGAAGGCAATTTAATTTAAC
TTAGAAACCTCTGAATACAAGAAAATACTTTTTAAATCTTACTATTCTGTCGTTGAAGGA
CTTGCTTTTGTTTGTAATTAAAAGCTTAAGCACTTGCCTATTTACATAAAGCTCCATTCC
GACGATCCCTTATTTACTTCTTTGATTGATTATATTAGTTACTACATTCCTTAGGGTCAG
ATAGGAGATGAAAAGAAATTAGAATCAAATGAAAATAGCAATGATCACTCAAATAATAAT
GACATAAAAAACAAAATAATGGAAGCTGAAAAAGAAGATGAAAATAAATTGAAATTAAAA
CCATTTGAAGAATCTTATTTATTTTAATAACAATATCAAAATCAAAAGTAAATTTCTGAT
ATTCAGATTATCTTACTTTAATTCTGTAAGTTGACGCTAAGCAATCCTAAATTTATTCAT
TCTCAGTTTGGTGTTTATATTTTTAAGAATTTCTTTGATTGTCAAAACAAAGAAATAGTT
GATCTTCTCAGAAAGAATCTAGCTTGCTGTCGTCTTTAAGGTGATAAATAGTCAGGATTT
CCTCCTTTTTGGAGAGCTTTTGATGAAATAGTGAACTAATTATTAGATGAAGGCAAGGAT
ATGAGTGTGATTAAAAAGTTTGTAGTTTTTACTCATAAATCATATTTCTCAGAAACTATA
AATGAAGGCAATGTCCAAGTGAAACCTAAAGAACATTTTAAGGAGCTCTGTGAAAGGTAA
ATTTATTTCCTGACAGCAAAGACAGCAGTCTTAATCAACACTCCTAATAAACTAAATACA
CTTAATGCTATTGGATATTTGCTTTAAATTAAGATTAACTACCCAAAATCGCTTGATCCC
AACCATTTGATGTATATCCAATCGCTTTAAAAGAAGTATCAAACATTCTTTTTGAAAAAA
ACATAAGACTATGTGCAAGAATTTAAATAAAATAATCAACATCTCTAATCTCTAGATGAA
ACAATACTCTCTGAGAAATCTAAAGAGATTATTTACAGATATGTTAAGAACCTAGAATCA
TGGTCTTAGGTTAAATTTAATGTAGATCCTTATGGAGAGGGATAAGAAGCTCTCGAAAAG
TAAAGAGAGCAAGCAGAGAGAAGTCTTAAAAAAGAATAAAAGCAAGAAAATGCTGATGAG
AAATCTGATTTAGTAAGTGAAAGTGAAGATGAAGAAGTTTAAGATTAAGATTAAGAGGAA
AGTGTAGAAGAAAAGAATAATACAACTGATAAAAAATAATCACATAAATCGAAATAAGTA
AATAAAAAAACAAGAAGCAGCAGTAGAAGTTCATCTAAAAATTAAAAATCTTCAAAAAAA
ATGGACGAAAATAAATAAAAACCCACTTCATCAGTTAAAAAAACAAAGAAAGAGCAAAAA
TCATCAGTTAAAATAAACATAAAATAATAATAAGAAGAAAGCAGTAAAGTTGAAACTGTT
AAAAAAAATCATAGAAGATAAAAGAAGAATTGA


>TTHERM_00225630(protein)
MPPKKSGQSRGNQRQANQQKSKPISEYTDYNLYEQLSRENCSIEEILDQIKDVDDQETKE
NILQNFVQLIFKLVGLNSFVIKLEDKQFSSIDQDFFKSEIESNLKNVKDFNWVFTTRKEE
HQFLKDNLFIFFDSILQQSQYYKSEKKDDSFMVNLSNFLIMLSKSHIQNVRQNVLRLVRI
IVEQGLIRIEKLRAAQQRKLQKEEQYLKNILENIMNILIKGIFHSRILDKSQSIQQDCIE
SFEIFFNISPQMTLNSQNLIQLCYLFDSDIDLANALLKVLINIKWKETESSLEALKELVQ
YDKFRKRLIYFSNISTFVTSYRAIQLVNLIDEILPGSLNNKDLKRAMATIFHKYEEVRAE
GFKILQKFLEVNEGERQISVINLEGGEDDGVSDIFQFKQQTNSLACQTFIKKFYTLLDEV
DSKIYEKEDLIQNMINSLGFEFGAIYDFQNIFQLLNQLPSSNLKDKIFDLFKLIVIILKK
TMKFLQLISQGENPSSIYNQKQSEKLLIIRNEFFKALVANFDNFYENMNKHPILKEYSYQ
LLLSIPAIDLQQNLKETQFKTISKKIAEDILNTILNQDSFIEDKSQSMGLVFGCVSTLQY
FLLHTPRAYIDPFKQCKEKLIKHAILDCTDNLHEIVVQEKETSLDLSQLQEEYTYLFIKL
FSCTNLLNQLDEIYCESFIQKCLEITDTATSYTSTDNTCIYTFTSLGLQLDFYLNVLRVG
LSESCQKTSRLEEYLKYRQKVIKQLWLFLREEKKKAIQFNLETSEYKKILFKSYYSVVEG
LAFVCNQKLKHLPIYIKLHSDDPLFTSLIDYISYYIPQGQIGDEKKLESNENSNDHSNNN
DIKNKIMEAEKEDENKLKLKPFEESYLFQQQYQNQKQISDIQIILLQFCKLTLSNPKFIH
SQFGVYIFKNFFDCQNKEIVDLLRKNLACCRLQGDKQSGFPPFWRAFDEIVNQLLDEGKD
MSVIKKFVVFTHKSYFSETINEGNVQVKPKEHFKELCERQIYFLTAKTAVLINTPNKLNT
LNAIGYLLQIKINYPKSLDPNHLMYIQSLQKKYQTFFLKKTQDYVQEFKQNNQHLQSLDE
TILSEKSKEIIYRYVKNLESWSQVKFNVDPYGEGQEALEKQREQAERSLKKEQKQENADE
KSDLVSESEDEEVQDQDQEESVEEKNNTTDKKQSHKSKQVNKKTRSSSRSSSKNQKSSKK
MDENKQKPTSSVKKTKKEQKSSVKINIKQQQEESSKVETVKKNHRRQKKN


>TTHERM_00225630(gene)
ATGGTAAAACAATTATTTATTTATTGTTTTTGCTTGAATAAAATCTATTTTTTATTTTTA
AAAGCCTCCTAAAAAATCTGGATAAAGCAGGGGAAACCAGCGTTAGGCAAACTAATAAAA
ATCAAAGCCAATTTCAGAGTATACTGATTATAATTTATATGGTAATTTAGCAAACATATG
CTTAGTTGAGATAATAACATAATTAAATATTAAATATAATCAAGAGTAATTATCAAGAGA
AAATTGTTCGATTGAAGAGATTTTAGATCAAATAAAAGATGTAGATGATTAAGAAACAAA
AGAGAATATCCTATAAAACTTTGTTCAGTTGATTTTTAAAGTAATTTAAAGTAATTGTTG
GTATTTAATGTTGCTATAATTAATTTACTTATTAATATAGCTAGTAGGACTCAATAGTTT
TGTGATAAAATTAGAAGACAAATAATTTTCTTCTATTGATTAGGATTTTTTCAAATCAGA
AATAGAATCTAATTTAAAAAATGTTAAGGATTTTAATTGGGTTTTTACTACAAGAAAAGA
AGAGCACTAGTTCCTCAAAGACAATCTCTTTATTTTCTTTGACTCAATTTTATAGCAAAG
TCAATATTACAAATCAGAAAAAAAGGATGATTCTTTTATGGTAAATCTCTCTAATTTCCT
AATTATGTTATCAAAGTAAATTAGTTTTATTGAAATGATTTGAAAATTATTTTGAATAAG
CATCAAATTAACTTATAAAATGTAAATTAGATCCCATATTTAGAATGTAAGATAGAATGT
ATTGAGATTAGTAAGGATTATAGTTGAGTAGGGCTTGATTAGAATAGAGAAATTGAGGGC
TGCTTAATAGAGAAAATTATAGAAAGAAGAGCAATATTTAAAAAACATTCTTGAAAACAT
TATGAATATATTGATTAAAGGTATTTTCCATAGTAGAATTTTAGATAAGAGTCAGTCAAT
ATAGCAAGATTGTATTGAATCTTTTGAGATTTTCTTTAATATTTCTCCTTAAATGACTTT
GAATTCTTAGAATCTCATTTAATTGTGTTATTTATTTGATTCTGATATTGATCTCGCTAA
TGCACTCTTAAAAGTACTTATCAATATAAAATGGAAAGAAACAGAGTCATCTTTGGAGGC
TCTTAAAGAGTTAGTTCAATATGATAAATTCAGGAAGAGATTAATTTATTTTTCTAACAT
TTCAACATTTGTCACAAGTTACAGAGCTATTCAATTAGTTAACCTGATAGATGAAATTCT
ACCTGGATCACTCAACAACAAAGACTTAAAAAGAGTATTTATTTATTTGTTTGTTATTAA
GATATTTAATTGGTTAATTTTTATTTTTAATATAGGCAATGGCAACTATCTTCCATAAAT
ATGAAGAAGTCAGAGCAGAGGGATTTAAGATTCTTTAAAAATTTTTAGAAGTTAATGAGG
GTGAAAGATAAATTAGCGTCATAAATCTCGAAGGAGGCGAAGACGATGGTGTTAGCGATA
TTTTCTAGTTCAAAGTAAGTTTTAAGCTGTATTTGAATGCGTTTTATTAAATATTTTTAA
AAATAGTAATAAACCAATTCTTTAGCCTGTTAAACTTTTATAAAGAAATTTTATACACTT
TTGGATGAAGTGGATTCCAAAATTTATGAAAAAGAAGATTTGATCTAAAATATGATAAAT
TCTCTTGGTTTTGAATTTGGTGCTATTTACGATTTCCAAAATATTTTCCAATTGCTAAAT
TAGTTACCATCATCGAATTTAAAAGATAAAATTTTTGATTTGTTTAAATTGATTGTTATA
ATTTTGAAAAAAACGATGAAATTCTTATAGCTAATATCGTAAGGCGAGAATCCATCGAGC
ATTTACAACCAAAAGCAATCAGAAAAGTTGCTTATCATTAGAAATGAATTCTTTAAAGCC
TTGGTGGCTAATTTTGATAACTTTTATGAGAATATGAATAAACACCCTATCTTAAAAGAG
TATTCTTACCAATTATTGCTATCAATTCCAGCTATAGACCTCCAACAGAATTTAAAAGAA
ACCTAGTTCAAAACAATATCAAAGAAAATAGCTGAAGACATACTAAATACAATACTAAAC
TAAGATTCTTTCATTGAAGATAAATCTTAATCTATGGGACTTGTTTTTGGATGCGTTAGC
ACCCTTTAATACTTCCTCTTACACACCCCAAGGGCCTACATCGATCCTTTTAAAGTAAAA
ATATTACATTCATTTATATGATAAAAAACATTCATCTCTTCTTTTTAAAAATTAAAATTT
TTATTATTCAACTAACTAAATTATCATTGAAAATTTCTAATATTTTGGCACTGAAATTTA
CTTATTAATAATTTTAATTAAAATGGATATTGAAGTTATAATCAATTCAACAGCAATATT
ATATATATTCTTAAAATGAAAATTAATATTTAAAAAATTTAATTCAAAATTATTTAAAAC
AAATATTTTACTTGGCTAATTTAAAAAAAAAATATTTTAAATTTATAAATTTGAAAAAAA
AATATTTTAAATTTATAAATTTGAAAGAAAACTTATTTCTGTTTAAATTTATTAAATTTC
AATAATTAATTGAAGAGGATTTAAATAGTTTTTTTGAATTTTCTAATATTGTTAATTATA
TAAAAAAATAAAGTAATGCAAGGAGAAATTGATTAAACATGCGATTTTAGATTGTACTGA
CAATTTACATGAAATAGTAGTTCAAGAAAAGGAGACGTCTTTAGATTTGTCTTAGCTGTA
AGAAGAATATACTTATTTGTTTATTAAATTGTTTAGCTGCACCAATCTCTTAAATTAATT
GGATGAAATATATTGTGAAAGTTTTATATAAAAGTGCTTAGAAATCACTGATACAGCTAC
TTCATATACTTCAACTGACAACACTTGCATTTATACTTTTACTAGTTTAGGGTTACAATT
AGACTTTTACTTGAACGTATTGAGAGTTGGATTGTCTGAATCTTGCTAAAAAACTTCAAG
ACTTGAAGAGTATCTTAAGTATAGGTAAAAAGTTATCAAATAGCTCTGGCTCTTCCTTAG
AGAAGAGAAGAAGAAGGCAATTTAATTTAACTTAGAAACCTCTGAATACAAGAAAATACT
TTTTAAATCTTACTATTCTGTCGTTGAAGGACTTGCTTTTGTTTGTAATTAAAAGCTTAA
GCACTTGCCTATTTACATAAAGCTCCATTCCGACGATCCCTTATTTACTTCTTTGATTGA
TTATATTAGTTACTACATTCCTTAGGGTCAGATAGGAGATGAAAAGAAATTAGAATCAAA
TGAAAATAGCAATGATCACTCAAATAATAATGACATAAAAAACAAAATAATGGAAGCTGA
AAAAGAAGATGAAAATAAATTGAAATTAAAACCATTTGAAGAATCTTATTTATTTTAATA
ACAATATCAAAATCAAAAGTAAATTTCTGATATTCAGATTATCTTACTTTAATTCTGTAA
GTTGACGCTAAGCAATCCTAAATTTATTCATTCTCAGTTTGGTGTTTATATTTTTAAGAA
TTTCTTTGATTGTCAAAACAAAGAAATAGTTGATCTTCTCAGAAAGAATCTAGCTTGCTG
TCGTCTTTAAGGTGATAAATAGTCAGGATTTCCTCCTTTTTGGAGAGCTTTTGATGAAAT
AGTGAACTAATTATTAGATGAAGGCAAGGATATGAGTGTGATTAAAAAGTTTGTAGTTTT
TACTCATAAATCATATTTCTCAGAAACTATAAATGAAGGCAATGTCCAAGTGAAACCTAA
AGAACATTTTAAGGAGCTCTGTGAAAGGTAAATTTATTTCCTGACAGCAAAGACAGCAGT
CTTAATCAACACTCCTAATAAACTAAATACACTTAATGCTATTGGATATTTGCTTTAAAT
TAAGATTAACTACCCAAAATCGCTTGATCCCAACCATTTGATGTATATCCAATCGCTTTA
AAAGAAGTATCAAACATTCTTTTTGAAAAAAACATAAGACTATGTGCAAGAATTTAAATA
AAATAATCAACATCTCTAATCTCTAGATGAAACAATACTCTCTGAGAAATCTAAAGAGAT
TATTTACAGATATGTTAAGAACCTAGAATCATGGGTATATTAAATTATTTTCTATATAAG
TTTAATCTTATTTATTTATTATAAAATCAATAGTCTTAGGTTAAATTTAATGTAGATCCT
TATGGAGAGGGATAAGAAGCTCTCGAAAAGTAAAGAGAGCAAGCAGAGAGAAGTCTTAAA
AAAGAATAAAAGCAAGAAAATGCTGATGAGAAATCTGATTTAGTAAGTGAAAGTGAAGAT
GAAGAAGTTTAAGATTAAGATTAAGAGGAAAGTGTAGAAGAAAAGAATAATACAACTGAT
AAAAAATAATCACATAAATCGAAATAAGTAAATAAAAAAACAAGAAGCAGCAGTAGAAGT
TCATCTAAAAATTAAAAATCTTCAAAAAAAATGGACGAAAATAAATAAAAACCCACTTCA
TCAGTTAAAAAAACAAAGAAAGAGCAAAAATCATCAGTTAAAATAAACATAAAATAATAA
TAAGAAGAAAGCAGTAAAGTTGAAACTGTTAAAAAAAATCATAGAAGATAAAAGAAGAAT
TGA