Identifiers and Description

Gene Model Identifier

TTHERM_00219490

Standard Name

None

Aliases

PreTt22377 | 18.m00403 | 3701.m00162

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05372 ) Delta lysin family
  • ( TIGR00537 ) methylase, putative
  • ( PF05185 ) Skb1 methyltransferase
  • ( PF08241 ) methyltransferase domain
  • ( PF08242 ) methyltransferase domain
  • ( TIGR00452 ) methyltransferase, putative
  • ( PF05175 ) methyltransferase small domain
  • ( TIGR01444 ) methyltransferase, FkbM family
  • ( TIGR02072 ) biotin biosynthesis protein BioC
  • ( PF08003 ) Protein of unknown function (DUF1698)
  • ( PF06325 ) ribosomal protein L11 methyltransferase
  • ( TIGR00406 ) ribosomal protein L11 methyltransferase
  • ( PF02353 ) Cyclopropane-fatty-acyl-phospholipid synthase
  • ( TIGR01983 ) 3-demethylubiquinone-9 3-O-methyltransferase
  • ( TIGR02021 ) magnesium protoporphyrin O-methyltransferase
  • ( TIGR00438 ) ribosomal RNA large subunit methyltransferase
  • ( TIGR02469 ) precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00219490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06735.19.997093137033517e-262hypothetical protein (411 aa)
SGDYBR034C5.0008352594020174e-107HMT1 Nuclear SAM-dependent mon
o- and asymmetric arginine dim
ethylating methyltransferase t
hat modifies hnRNPs, including
Npl3p and Hrp1p, affecting th
eir activity and nuclear expor
t; methylates U1 snRNP protein
Snp1p and ribosomal protein R
ps2p
OxytrichaContig651.1.g157.000768000322042e-106PRMT5 arginine-N-methyltransfe
rase
DictyBaseDDB_G02915562.998957050488393e-103prmt1 on chromosome: 6 positio
n 504463 to 505870
WormBaseWBGene000137662.9994041385173996e-93locus:prmt-1 status:Confirme
d UniProt:Q9U2X0 protein_i
d:CAB54335.1
Stentor CoeruleusSteCoe_336941.1379798735078682e-50

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00219490(coding)
ATGGATCAAAAAAATAGCGAAAATAACTAGATGTAGATAGAAGAAGAAAACTCTTCTTAA
AAAATTAACTATTATCATAATCATGATGTTAATTAAAAACTTGACTGTTTGGAAGGTTAT
ATGCATAATCATAGGTCATAGTATTGCAAAATGTGCAAAAGGACAAGCAAAGATATTGGG
AATAATCACAATAATTTCAATTTAGATACATGTTTTGATAATGATAATATTAAAGAAGAA
AGTAAAGGATATGAAAGAAATCAAGATTACTATTATGATAGTTATTCCCACTTTAACATT
CATGAAGATATGCTCAAGGATAAAGTCAGAACCAAGGCATACATGAAATCTATCTTAGAT
AATAAGAATTTATTTGAAGGAAAGATTGTACTTGATATTGGTTGTGGTACAGGTATTTTA
AGTATTTTTGCTGCTAAGGCAGGGGCAAAGCATGTATATGGAGTTGATAACGCTAATATT
ATTTTACATGCAAAAGCAATTGTTAAAAATAATAATTTAGCAGACAAAATTACACTAATT
TAAGGTAAAATGGAAGAAGTAGAATTACCAGTAGAAAAAGTAGATATCATTATTTCTGAA
TGGATGGGTTATTTTTTACTTTATGAGTCTATGCTAGATTGTGTATTAGATGCAAGAGAC
AAATATTTAGCATCAGATGGTCTAATGTTTCCTAATAAGGCTACTATGTTTATCTCAAGC
TTCTGTAATGACGAAATATATAATTAAAGATTTGATTTTTGGGATAAAGTATATGGAGTT
GATATGTCTTGCATGAAATAATGGGTCTATAAAGAACCTTTAGTGGATTAAGCTGATAGA
GGGACTATTAATGGAGATTTTGTAAAATTAATAGAATTTGATTTAGAAACAGTGAAAAAA
ACTGATTTGGATTTTGTTGCTGAATACACTTTAAAGATAAGAAGAGATGATTATGTTTAG
GGAGTAATAATATGGTGGGATGTTTACTTTAATTATTGCAAAATACCAATTAAATTATCA
ACAAGCCCATTTGCAAGTGAAACTCATTGGAAATAAACTATGTTCTTTATAGAAAATGAG
GATATACCTGTGATTAAAGGTGATACCTTATCAGGTAAAGTAGCTGTAAAGAAATGTACT
AAAAATCCAAGAGATTTGGATATAAAAATACAATTTAAACTTGAAAACCGCGAAATAGAT
TTTGACAAATCTTTTGTCTACAAAATGAATTGA


>TTHERM_00219490(protein)
MDQKNSENNQMQIEEENSSQKINYYHNHDVNQKLDCLEGYMHNHRSQYCKMCKRTSKDIG
NNHNNFNLDTCFDNDNIKEESKGYERNQDYYYDSYSHFNIHEDMLKDKVRTKAYMKSILD
NKNLFEGKIVLDIGCGTGILSIFAAKAGAKHVYGVDNANIILHAKAIVKNNNLADKITLI
QGKMEEVELPVEKVDIIISEWMGYFLLYESMLDCVLDARDKYLASDGLMFPNKATMFISS
FCNDEIYNQRFDFWDKVYGVDMSCMKQWVYKEPLVDQADRGTINGDFVKLIEFDLETVKK
TDLDFVAEYTLKIRRDDYVQGVIIWWDVYFNYCKIPIKLSTSPFASETHWKQTMFFIENE
DIPVIKGDTLSGKVAVKKCTKNPRDLDIKIQFKLENREIDFDKSFVYKMN


>TTHERM_00219490(gene)
ATGGATCAAAAAAATAGCGAAAATAACTAGATGTAGATAGAAGAAGAAAACTCTTCTTAA
AAAATTAACTATTATCATAATCATGATGTTAATTAAAAACTTGACTGTTTGGAAGGTTAT
ATGCATAATCATAGGTCATAGTATTGCAAAATGTGCAAAAGGACAAGCAAAGATATTGGG
AATAATCACAATAATTTCAATTTAGATACATGTTTTGATAATGATAATATTAAAGAAGAA
AGTAAAGGATATGAAAGAAATCAAGATTACTATTATGATAGTTATTCCCACTTTAACATT
CATGAAGATATGCTCAAGGATAAAGTCAGAACCAAGGCATACATGAAATCTATCTTAGAT
AATAAGAATTTATTTGAAGGAAAGATTGTACTTGATATTGGTTGTGGTACAGGTATTTTA
AGTATTTTTGCTGCTAAGGCAGGGGCAAAGCATGTATATGGAGTTGATAACGCTAATATT
ATTTTACATGCAAAAGCAATTGTTAAAAATAATAATTTAGCAGACAAAATTACACTAATT
TAAGGTAAAATGGAAGAAGTAGAATTACCAGTAGAAAAAGTAGATATCATTATTTCTGAA
TGGATGGGTTATTTTTTACTTTATGAGTCTATGCTAGATTGTGTATTAGATGCAAGAGAC
AAATATTTAGCATCAGATGGTCTAATGTTTCCTAATAAGGTATTAACAAAATTTGTTAAT
TTTGAATATTCCTTTCTTAATATATATGTTTTCCATTAAACTTAAAAAATTATTATTAGG
CTACTATGTTTATCTCAAGCTTCTGTAATGACGAAATATATAATTAAAGATTTGATTTTT
GGGATAAAGTATATGGAGTTGATATGTCTTGCATGAAATAATGGGTCTATAAAGAACCTT
TAGTGGAGTAAATTATTTACATATGTTTATTAATAAGAAGAATAAGTAATTTACTACTGT
ATAAATAATTAATAGTTAAGCTGATAGAGGGACTATTAATGGAGATTTTGTAAAATTAAT
AGAATTTGATTTAGAAACAGTGAAAAAAACTGATTTGGATTTTGTTGCTGAATACACTTT
AAAGATAAGAAGAGATGATTATGTTTAGGGAGTAATAATATGGTGGGATGTTTACTTTAA
TTATTGCAAAATACCAATTAAATTATCAACAAGCCCATTTGCAAGTGAAACTCATTGGAA
ATAAACTATGTTCTTTATAGAAAATGAGGATATACCTGTGATTAAAGGTGATACCTTATC
AGGTAAAGTAGCTGTAAAGAAATGTACTAAAAATCCAAGAGATTTGGATATAAAAATACA
ATTTAAACTTGAAAACCGCGAAATAGATTTTGACAAATCTTTTGTCTACAAAATGAATTG
A