Identifiers and Description

Gene Model Identifier

TTHERM_00219449

Standard Name

PIK1  (Phosphatidyl Inositol Kinase )

Aliases

3701.m01490

Description

phosphatidylinositol 4-kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08912 ) Rho Binding
  • ( PF01363 ) FYVE zinc finger
  • ( TIGR00264 ) alpha-NAC homolog
  • ( PF00454 ) Phosphatidylinositol 3- and 4-kinase
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 73.5%

TetraMine Data

TTHERM_00219449

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06724.19.996373193201036e-79phosphatidylinositol 4-kinase
(2022 aa)
WormBaseWBGene000191850.0000000020002373268528243status:Partially_confirmed U
niProt:O76671 protein_id:CCD
68273.1
OxytrichaContig17690.0.g280.0000000039998859049333245Ring finger domain
SGDYNL116W0.0000899730839127287DMA2 Protein involved in ubiqu
itination; plays a role in reg
ulating spindle position and o
rientation; functionally redun
dant with Dma1p; orthologous t
o human RNF8 protein, also has
sequence similarity to human
Chfr

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00219449(protein)
MKEIKSVFLMLVFFHFILTASEIRQLQSQDVNEIDEQTPISFQQIDQQSSFVYKVKSQKY
IMVSLILKSQVIQNSSYKVEMCSTKNNSVLVKSNDSNYLLSVSADQCDTQSYQQNSLNHY
LFYQPQQISVGDQIYISVIMSRALNSLVYTLQLETSDQQMCPQQCSNQGSCLTSCQCQCN
PGYFKNDCSVQAPQLKLNNVWKGYIQFQQTQYLSINFNDASFKQEQLSMVQINFQKESNS
KVRLLDTSPSSSNGPEYLIISYIFVNKQGNQIPSLTNSDSTQYMITNEYSLNFVSQQIQS
LADKNHLVISIYSNYTSTSYISVEVVNQQNQEDDSLKTKIFIFFFSGFGVIVLLWLMLLV
YRAYKRRQLERSRFQQALESIVNRRTNRVSPSKLTLSNDMVEKYMPIRIYKDILERLKHP
YKNLACELLLAQQFQKQIQQEQMESQKFGKEMSLKTIQQNQHQQIDQERNDISTLQNKRT
NNDVSILNENQQDQTNAFINQQNFENAYQDQNEINLFRNNSNNFENSVQFNQANVESFQD
EDEIQCENQEDGGLSKDIECQQNQENQVQQQQNPIQEEQCSVCLIEFQESDQIRITICDH
IFHSECLLQWLKSQENCPNCRKDLQRRKLKYWYSIQVRKQLRIMMNDRSAYSINLFLGQP
KSKSTTFGEQVAESNQQQQFYRKTPMFPFNKVKQLKRFNSLQGEFYHNSQTQGNILNNGQ
KTETDNIQQTNQLGQNNSKSIQRPTQVEYQEVSFNGAIVRIPKPKIETNTQKVIEVENEE
EEEKKEQLEEQNQDICIQQIQNEQIIEQNSKIKNDSLSIQQENKSDLNQNGSNKHIDLKQ
NDNQNMFECISLNNSIQIEDCQQENSQCFRKRKHLRESWFKKSEQSKQILNIEEDNSSMK
TIEKDNFNQKIEEQQIAGDYKSIRKDSLNQENIKQNISDDESIINLNINQTNNQIKNHIE
IKTKQIDLQNQQQQKNVNLDLSETSKNKQNDINHSIKESNKSMNENNFGQKLKQSDDQFN
CELIDLENRQESPCKIDSITQKLELNEDFDPSIFRLQTEDLTKSNQIKQVNKCKEKSHTA
IRNNKKIIQQDTTPSKRTKQTKQTKQLNLNSLSSKDTNPSPKLFITPQKNSFNNHQIQKY
QPCSSPILLQNASSILNNKIKTQNETLVSQQEHKIFLKSQIRNSQEIKS


>TTHERM_00219449(coding)
ATGAAAGAAATTAAATCCGTTTTTTTGATGCTAGTTTTTTTCCATTTTATTTTAACTGCT
AGTGAAATTAGATAATTACAAAGCTAAGATGTTAATGAGATTGATGAATAAACACCTATT
TCATTTTAGTAAATTGATTAATAGAGTTCGTTCGTTTATAAAGTGAAATCACAAAAATAT
ATAATGGTTAGTCTCATTCTTAAATCATAAGTTATTTAGAACAGTAGTTATAAGGTTGAG
ATGTGTTCTACTAAAAATAATTCTGTATTAGTTAAAAGCAATGATTCTAACTATCTATTA
AGTGTATCAGCAGACTAGTGTGATACGTAAAGTTACTAATAAAATAGCTTAAATCACTAT
TTATTTTATTAGCCTTAATAAATTAGTGTTGGAGATCAAATATATATCAGTGTTATTATG
AGTAGAGCACTCAATAGTTTAGTTTATACTTTATAATTAGAAACCAGTGATTAATAAATG
TGCCCTTAATAGTGTTCTAACTAAGGAAGTTGCTTAACTTCGTGTTAATGTTAATGCAAT
CCTGGATACTTCAAAAATGATTGTAGTGTTTAAGCTCCATAACTAAAATTGAATAATGTA
TGGAAAGGATATATTCAATTTCAATAAACTTAATATTTGAGCATTAATTTTAATGATGCT
TCTTTCAAGCAAGAGTAACTTTCTATGGTTTAAATTAATTTTTAAAAGGAAAGCAATTCT
AAAGTAAGACTTTTAGATACTTCTCCTAGCAGTAGTAATGGGCCGGAATATTTAATAATC
TCATATATATTTGTAAATAAGTAAGGTAACTAAATCCCTTCTTTGACGAATTCAGACTCC
ACTTAATATATGATAACAAATGAATATAGTTTGAATTTTGTATCATAGCAAATATAAAGT
TTGGCTGATAAAAATCATTTGGTTATTTCTATTTATTCAAACTATACTTCAACTAGTTAT
ATTTCAGTTGAAGTAGTTAATTAGTAGAATCAAGAAGATGATTCATTAAAAACTAAAATC
TTTATTTTTTTCTTTTCTGGTTTTGGAGTTATAGTACTTCTATGGCTTATGCTTTTAGTT
TACAGAGCTTACAAAAGAAGGCAGTTAGAAAGAAGTAGATTTTAGCAAGCTTTAGAGTCA
ATTGTGAATAGGCGCACTAATAGGGTATCTCCAAGCAAACTTACTTTGAGCAATGATATG
GTTGAAAAGTATATGCCTATTAGAATTTATAAAGATATTTTAGAAAGATTGAAACATCCT
TACAAAAATTTAGCATGTGAATTATTGCTGGCATAATAGTTTTAGAAATAAATTCAATAA
GAATAAATGGAAAGTTAAAAATTTGGAAAAGAAATGTCATTGAAAACGATTTAATAAAAT
TAACACCAATAAATTGATTAAGAAAGAAATGATATTTCTACATTATAAAATAAAAGAACT
AATAATGATGTTTCAATACTAAATGAGAACTAGTAAGACTAAACAAATGCTTTCATAAAT
TAACAAAATTTTGAAAATGCTTATTAAGATTAAAACGAAATAAATTTATTTAGAAATAAT
TCAAACAATTTTGAAAATTCAGTGTAATTCAACTAAGCAAATGTAGAGAGCTTTCAAGAT
GAAGATGAAATCTAATGTGAAAATTAAGAAGATGGTGGTTTGAGTAAAGACATAGAATGT
TAGCAGAATTAAGAAAATTAAGTGCAATAATAATAGAATCCAATATAAGAAGAGTAATGC
TCTGTTTGCTTAATAGAGTTTTAAGAGAGTGATTAAATTAGAATTACTATATGTGATCAT
ATTTTTCATAGTGAGTGCTTATTGTAGTGGCTGAAAAGTTAAGAAAATTGTCCAAACTGT
AGAAAAGACCTGCAAAGGAGAAAATTAAAATATTGGTATTCTATTCAAGTAAGAAAATAG
CTCAGAATTATGATGAATGATAGAAGTGCTTATTCTATAAATTTGTTTTTAGGTTAACCT
AAATCAAAATCTACTACTTTTGGAGAGTAAGTTGCTGAATCAAATCAATAGTAATAGTTT
TATAGAAAGACTCCTATGTTTCCTTTTAACAAAGTAAAATAATTAAAAAGATTTAATAGC
TTGCAAGGAGAGTTCTATCATAACTCATAGACTTAAGGAAATATATTAAATAATGGTTAA
AAAACTGAAACAGATAACATTTAATAAACTAATTAGCTGGGTTAAAACAATTCAAAAAGT
ATTTAAAGACCTACTCAAGTCGAGTATTAAGAAGTTTCTTTTAATGGAGCAATTGTTAGA
ATCCCAAAACCTAAAATAGAAACAAATACTCAAAAAGTGATAGAAGTTGAAAATGAAGAG
GAAGAAGAAAAAAAAGAATAGCTTGAGGAATAAAATTAAGATATTTGTATTTAATAAATT
TAGAACGAGTAAATTATTGAGTAAAACTCGAAAATTAAAAATGACAGTTTGAGTATTTAA
TAAGAAAATAAGAGTGATTTGAATTAAAATGGAAGCAATAAGCATATTGATTTGAAATAA
AATGATAATTAAAATATGTTCGAATGTATTTCATTAAATAATTCTATACAGATTGAAGAT
TGCTAGTAAGAAAACTCATAATGTTTTAGAAAAAGAAAGCACTTAAGAGAGAGTTGGTTT
AAAAAATCTGAATAAAGCAAATAAATTCTAAATATTGAAGAAGATAATTCTAGCATGAAG
ACTATTGAAAAAGATAACTTCAATTAGAAAATAGAAGAACAGCAAATAGCAGGAGATTAT
AAAAGTATTAGAAAAGATTCCCTTAATTAGGAAAATATAAAATAAAATATAAGTGACGAT
GAAAGCATAATAAATCTGAATATAAATCAAACTAACAATTAAATTAAAAACCATATAGAA
ATTAAAACAAAATAAATAGATTTATAAAATCAACAATAATAAAAAAATGTAAATTTAGAT
TTAAGTGAAACTTCAAAAAACAAATAAAACGATATAAATCATTCTATAAAAGAAAGTAAT
AAAAGTATGAATGAAAATAATTTTGGATAAAAATTGAAGCAAAGCGATGATTAATTTAAT
TGCGAGTTAATTGATCTTGAAAATAGACAAGAATCTCCTTGTAAAATTGACTCAATAACT
TAAAAATTAGAATTGAATGAAGATTTTGATCCCTCAATTTTCCGTTTGTAAACAGAAGAT
TTAACTAAATCAAATTAGATAAAATAAGTTAATAAATGTAAAGAGAAATCTCATACAGCT
ATCCGAAATAATAAAAAGATTATTTAATAAGACACAACTCCTTCAAAGAGAACAAAACAA
ACAAAATAAACAAAATAACTTAACTTAAATAGCTTGAGCTCAAAGGATACCAATCCTAGT
CCTAAATTGTTTATAACTCCTTAAAAAAACAGCTTTAATAATCATTAAATATAAAAATAT
CAACCCTGTTCATCTCCAATACTCTTATAAAATGCTTCAAGCATTTTAAATAACAAAATA
AAAACATAAAACGAAACTTTGGTTTCACAATAGGAACATAAAATTTTTTTAAAAAGTTAG
ATTAGAAATAGTTAAGAAATAAAATCTTGA


>TTHERM_00219449(gene)
AGTGGTTAATAGCAAATTAAATAATCTGAATTATTTTTAAGCTCAGATAAACCAAATACA
GCTTAAAGAATCACATATTTTTTTACTTAAAGCAAGTGTAGATCCATTAAAAAAGCTAGA
ATTTAAAAAATCATGAAAGAAATTAAATCCGTTTTTTTGATGCTAGTTTTTTTCCATTTT
ATTTTAACTGCTAGTGAAATTAGATAATTACAAAGCTAAGATGTTAATGAGATTGATGAA
TAAACACCTATTTCATTTTAGTAAATTGATTAATAGAGTTCGTTCGTTTATAAAGTGAAA
TCACAAAAATATATAATGGTTAGTCTCATTCTTAAATCATAAGTTATTTAGAACAGTAGT
TATAAGGTTGAGATGTGTTCTACTAAAAATAATTCTGTATTAGTTAAAAGCAATGATTCT
AACTATCTATTAAGTGTATCAGCAGACTAGTGTGATACGTAAAGTTACTAATAAAATAGC
TTAAATCACTATTTATTTTATTAGCCTTAATAAATTAGTGTTGGAGATCAAATATATATC
AGTGTTATTATGAGTAGAGCACTCAATAGTTTAGTTTATACTTTATAATTAGAAACCAGT
GATTAATAAATGTGCCCTTAATAGTGTTCTAACTAAGGAAGTTGCTTAACTTCGTGTTAA
TGTTAATGCAATCCTGGATACTTCAAAAATGATTGTAGTGTTTAAGCTCCATAACTAAAA
TTGAATAATGTATGGAAAGGATATATTCAATTTCAATAAACTTAATATTTGAGCATTAAT
TTTAATGATGCTTCTTTCAAGCAAGAGTAACTTTCTATGGTTTAAATTAATTTTTAAAAG
GAAAGCAATTCTAAAGTAAGACTTTTAGATACTTCTCCTAGCAGTAGTAATGGGCCGGAA
TATTTAATAATCTCATATATATTTGTAAATAAGTAAGGTAACTAAATCCCTTCTTTGACG
AATTCAGACTCCACTTAATATATGATAACAAATGAATATAGTTTGAATTTTGTATCATAG
CAAATATAAAGTTTGGCTGATAAAAATCATTTGGTTATTTCTATTTATTCAAACTATACT
TCAACTAGTTATATTTCAGTTGAAGTAGTTAATTAGTAGAATCAAGAAGATGATTCATTA
AAAACTAAAATCTTTATTTTTTTCTTTTCTGGTTTTGGAGTTATAGTACTTCTATGGCTT
ATGCTTTTAGTTTACAGAGCTTACAAAAGAAGGCAGTTAGAAAGAAGTAGATTTTAGCAA
GTATAAAAAGATATATTATTATTCATCATTTTATAAAAAAACTTATTTTATATATGAAAA
AAAAGGCTTTAGAGTCAATTGTGAATAGGCGCACTAATAGGGTATCTCCAAGCAAACTTA
CTTTGAGCAATGATATGGTTGAAAAGTATATGCCTATTAGAATTTATAAAGATATTTTAG
AAAGATTGAAACATCCTTACAAAAATTTAGCATGTGAATTATTGCTGGCATAATAGTTTT
AGAAATAAATTCAATAAGAATAAATGGAAAGTTAAAAATTTGGAAAAGAAATGTCATTGA
AAACGATTTAATAAAATTAACACCAATAAATTGATTAAGAAAGAAATGATATTTCTACAT
TATAAAATAAAAGAACTAATAATGATGTTTCAATACTAAATGAGAACTAGTAAGACTAAA
CAAATGCTTTCATAAATTAACAAAATTTTGAAAATGCTTATTAAGATTAAAACGAAATAA
ATTTATTTAGAAATAATTCAAACAATTTTGAAAATTCAGGTAAATATTTTTTTTTATTTT
TAGTAAATATTTTATCTAATAATTTAAAAGTGTAATTCAACTAAGCAAATGTAGAGAGCT
TTCAAGATGAAGATGAAATCTAATGTGAAAATTAAGAAGATGGTGGTTTGAGTAAAGACA
TAGAATGTTAGCAGAATTAAGAAAATTAAGTGCAATAATAATAGAATCCAATATAAGAAG
AGTAATGCTCTGTTTGCTTAATAGAGTTTTAAGAGAGTGATTAAATTAGAATTACTATAT
GTGATCATATTTTTCATAGTGAGTGCTTATTGTAGTGGCTGAAAAGTTAAGAAAATTGTC
CAAACTGTAGAAAAGACCTGCAAAGGAGAAAATTAAAATATTGGTATTCTATTCAAGTAA
GAAAATAGCTCAGAATTATGATGAATGATAGAAGTGCTTATTCTATAAATTTGTTTTTAG
GTTAACCTAAATCAAAATCTACTACTTTTGGAGAGTAAGTTGCTGAATCAAATCAATAGT
AATAGTTTTATAGAAAGACTCCTATGTTTCCTTTTAACAAAGTAAAATAATTAAAAAGAT
TTAATAGCTTGCAAGGAGAGTTCTATCATAACTCATAGACTTAAGGAAATATATTAAATA
ATGGTTAAAAAACTGAAACAGATAACATTTAATAAACTAATTAGCTGGGTTAAAACAATT
CAAAAAGTATTTAAAGACCTACTCAAGTCGAGTATTAAGAAGTTTCTTTTAATGGAGCAA
TTGTTAGAATCCCAAAACCTAAAATAGAAACAAATACTCAAAAAGTGATAGAAGTTGAAA
ATGAAGAGGAAGAAGAAAAAAAAGAATAGCTTGAGGAATAAAATTAAGATATTTGTATTT
AATAAATTTAGAACGAGTAAATTATTGAGTAAAACTCGAAAATTAAAAATGACAGTTTGA
GTATTTAATAAGAAAATAAGAGTGATTTGAATTAAAATGGAAGCAATAAGCATATTGATT
TGAAATAAAATGATAATTAAAATATGTTCGAATGTATTTCATTAAATAATTCTATACAGA
TTGAAGATTGCTAGTAAGAAAACTCATAATGTTTTAGAAAAAGAAAGCACTTAAGAGAGA
GTTGGTTTAAAAAATCTGAATAAAGCAAATAAATTCTAAATATTGAAGAAGATAATTCTA
GCATGAAGACTATTGAAAAAGATAACTTCAATTAGAAAATAGAAGAACAGCAAATAGCAG
GAGATTATAAAAGTATTAGAAAAGATTCCCTTAATTAGGAAAATATAAAATAAAATATAA
GTGACGATGAAAGCATAATAAATCTGAATATAAATCAAACTAACAATTAAATTAAAAACC
ATATAGAAATTAAAACAAAATAAATAGATTTATAAAATCAACAATAATAAAAAAATGTAA
ATTTAGATTTAAGTGAAACTTCAAAAAACAAATAAAACGATATAAATCATTCTATAAAAG
AAAGTAATAAAAGTATGAATGAAAATAATTTTGGATAAAAATTGAAGCAAAGCGATGATT
AATTTAATTGCGAGTTAATTGATCTTGAAAATAGACAAGAATCTCCTTGTAAAATTGACT
CAATAACTTAAAAATTAGAATTGAATGAAGATTTTGATCCCTCAATTTTCCGTTTGTAAA
CAGAAGATTTAACTAAATCAAATTAGATAAAATAAGTTAATAAATGTAAAGAGAAATCTC
ATACAGCTATCCGAAATAATAAAAAGATTATTTAATAAGACACAACTCCTTCAAAGAGAA
CAAAACAAACAAAATAAACAAAATAACTTAACTTAAATAGCTTGAGCTCAAAGGATACCA
ATCCTAGTCCTAAATTGTTTATAACTCCTTAAAAAAACAGCTTTAATAATCATTAAATAT
AAAAATATCAACCCTGTTCATCTCCAATACTCTTATAAAATGCTTCAAGCATTTTAAATA
ACAAAATAAAAACATAAAACGAAACTTTGGTTTCACAATAGGAACATAAAATTTTTTTAA
AAAGTTAGATTAGAAATAGTTAAGAAATAAAATCTTGA