Identifiers and Description

Gene Model Identifier

TTHERM_00218470

Standard Name

None

Aliases

PreTt22274 | 18.m00300 | 3701.m00060

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00218470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06621.19.997093137033517e-262hypothetical protein (1844 aa)
OxytrichaContig15180.0.g944.998711177326993e-55RING-H2 zinc finger
WormBaseWBGene000218311.999981404597394e-31E3 ubiquitin-protein ligase li
sterin status:Partially_conf
irmed UniProt:Q65XX2 prote
in_id:CCD72830.1
SGDYMR247C7.001594317853847e-31RKR1 RING domain E3 ubiquitin
ligase; involved in the ubiqui
tin-mediated degradation of no
n-stop proteins; functional co
nnections to chromatin modific
ation; nuclear protein that al
so co-localizes with ribosomes
; homolog of mouse Listerin, w
hose mutation has been reporte
d to cause neurodegeneration i
n mice
DictyBaseDDB_G02748751.000382677035467e-28rnf160 on chromosome: 2 positi
on 4311743 to 4317597
Stentor CoeruleusSteCoe_59887.781132241133797e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00218470(coding)
ATGGACGCAGTAGAATTAAAGTAAAAGAAAAAGGGAGGTAAAGATAAGTCAGCTCTTTCT
AAGCAAGGTTAGAGCACAGGTTTATTATCTCATGTAAATGAAAATGTTAACATGTTTTCA
CAATTATCAGCCATGTTTTTAGCAAACAAGGCTGAGAAATCAGACTAAGTAAAGAAGTTT
TTAGATAAGACAGAAGACAAACAAGTTTTTTAATAGCATTCTTACGATCCTGAAATATAA
TAATGTCTAAGTCAATTAAACAAAAAGAGTTAAATTACAAAGCTAAAAGCTTTAAACACT
CTCAAGGAACTTCTTTAGAAGTAACCTGAAGAGTTCTTTGAACAATTCATTTCTACATGG
ACTTATTTGTACAAGTAGTTTGTCAATTCAGAATATGATAGAAAAGTTTTTGAAGAAAGC
AATAATGTTTTAATTATTATCATTTCTAAAAACCGTAAATGTTTGCAAGCCTAGTTTAAG
GAACTCTTTCCTTATTGGTTTATATAAATGAATGATCCATCTGCTGATGTCTCATAAATT
GCTAATCAAGCTTTCGACAAGATGTTCCCTAAAGAAAAATAGGCCTAAGCGTTTAATTTA
TGCATGGAAAAGTACATTCTTAACTTAAAATATTACCTCAGTATAACGTAAAAGTAGATT
GAAAGCGAAAATAATAATTTAAGTGAGCATGAATCATAGGAAATATATGATAGATTAGTT
GTTTCCTCTCTTAATTCTATAGCAAGAGCAATTTAGCTTAATAAGGATAGCAAAGATCCA
AATATTTTTATTAGCTAATTGGAAGAAGAACTATTTGCACAGGGGAAAAAAAGCATACTC
ATAGAACTACTTTCTAAAAAGAGAATTAAAGTGCGTGCAGCTGTTATTGAAGTTTTATAG
GTTCTTATGAACACCATTTCATAAGAAGTTTTAGAATAAAATATTGAAGTTATAGCAAAA
AATATAATGCCACTTATTGATGATAAAGAAAGGTAAATTTAGTATTCTTTGTGGAAAGGA
TGTCTTTTAACTGTTTTGGATAAAGCTCCTGTTGCAATAATTGCTAAGTGTGACCTTAAA
ATGATTGAAGTCAAATCACTTGAAGTTCTTAAAAAAGCTGCTTCAGGTATCGGAAAGCAA
TTTTACTAAAACATCATTATCTTTTTAAGTAAACTACCTATGGCTGCATTCACTTCCATT
TTAAACAAAGAGAGTGTTTAATAACAGAACAAGTTTAATCCTGAAGAATATATTAAGGAA
AGATTCTCATTTATCAAAAAGTTCTTTGAGTCTATTCTTGCAGGTTTTACTCATGACGAA
ATTAAATTTTTCGGAGATTAGCTTGTTTAGTCATACTTTGAATGTATTTATTTCATTGTT
CTCAAAAGAATTTCTGTTGTTTTAGATAAAGAAGAAGTAAAATCCCTTAAAAATGTTTAG
AAATAAGCTCGTAACTTAATAAGAGATTTGATTTGCAATATATTAAATATCTATTTAGAA
TAAAATATTGCTGATAATGTAATGAATCCCTATAAATAAATCCCTAACTCATTGGGTTAA
CTAATTAACAATTTCAACACTGAATCAATCAATTCTAACGAAACAGATCTTTTTGATGAA
TTTGTTTATGAGTTTTCATCTATTTTTAGTAAGACAGCTAAGAAAGACACTACTAAATAC
AATAATTACATACTTTTATTATAGAGCATTGCAAATTTAGTCAACAAGAATAGTGTTTTG
TTTAATAAATTAGATTCAGCTGTTCAAAAGATGCATGAAGATCTCCTTAATGATCTAAAA
GGTCAAATTCAACCTTTAATGAATGATTCTCATATTGAAAAAATTCTGCCTATTTGCACT
TAATACAAGCTATATGCAAATTTATTCAATTCCAGCTAATAAAAATCCCAAAAAAAGCAA
GAATAAGAATAAGAAGAAGAATAAAAATCACCCGAAATATAATTAGGAGTTTTCTCAAAC
TTAGTTACTTAACAAACAGTAGCTTCTTTAGAAACAATTAATTTTTCAGTTTAATCAATT
ATTTAAAATATTAAAACAATAACAAATCCTACTTCTCTTGAAAAGTTTACAACTTTTATT
TCTTAAATTTATTATTCTTGGTCTGAATCACTAGATGAGCAACATCCTTAATATAGCTCA
TTTTAGCAAATCCTAAAAGATATTTAGAATCACATTAAAATGTTGAATCAAGTAGATCCT
AAAGCCCTCCTTCACTTATAATTTATACTTCATTTTGCTCTTCCTGAAACAAGTCCTACT
TACTTCTCCTAATTTTGCACTCATGTAAATAAAATAAAACCAATAGACGACATATTGATA
CTAAGGAATCTTAGCGCCTTGGAGTCTGCTTAATCTCAAAAAAATAGAGTTCACATGTGC
ACACGCCTATAAAATAACCAAGAATATTAGACCCTTGCTTTTGGAATTTTATCTCATATT
TTTGGAAAAATGGATAGATATTTAGGTGTTAGTTTACCTTTATTAGTTATCATTTTTAAA
AATTACTTAAACAGAGATAATAAAATTAAGTTGATTAGCTAGATTTAAGCCAACATTTCC
AAGAAGAGAGAATCAATCTTTAATGGAGAAATCTAAGAAAAAAATACAAGCAGAGTAATT
GATGAGCTTGAGCTAAATTACTTATTTTGCATATAAATTTACAAAGACCTCCCAAAAGTG
ATAGATCAAAACTTTGATCATTTACAATTTTTTAATGATTTCTTTAAATTTATTTATTTC
TGCTTTGAAAAGAAATTAAAATCTCGTATTCAATAAGCATTTAAGATATTTAAATACCTC
ATAAATGACTAAGCTGCATTAACTAGGATTATAGAGAATGCTACATGCATTTTTAAATTT
GAGCTGAATACTATCTTTATTGATAAAAAATAAACCAAATTCGATACTCTTCTTAAGTTG
ATAGTAGACACCTTCAGCTTCTTGAAAAGCCATAAAAAGAAAGACGAAATACTTTAACTC
ACTTCAACAATCCTCGAGCCTCAATATTTTGAAAATATAATATTCGAACAAAGAAATTGG
AGATTATTAGAAGCTCTGTTCGAGTAAATTACTGTATCTATTGACTTTAATGCTTACATT
TAGAAACTATTTGTCTCTTAAAATGGATTCTGGTTGATTTCAAATTTGATTAGCAGTTAA
CAGATATTTGCTATACTTAATTCAATTCAACTTAAAAAATATTTTAAGGACTTGGCAAAT
AATTTTATCAAACCCCTCATTCATAAATAAATTGAAGAAGAGTTTGAAACAGCCCTCCAA
TTCTTAAACTATATGATGAAATTGGCTATAGAAAAGAGTTTAATTTATGGTAACTCATTG
AAGGCTTGCTTAAAATAAATCATGATTGATGGAATAGAGACTCATAAACAATAACAAATA
TTCAATGATATAGTCAAAACAAAATTAGATTAACTTTTTGTATTGGAAAATATTGATCTG
ATGGTTCGTGAAGGTATTTTGATCAAAAATTTACTACCCCTATTTTAAGAATAGCTTGAA
AAAGATTCAGGTAGCATCGAAGATTTGTTACGTAAAAAGGTTAGCGAAGTTTGTAGAATG
AATGCCTAAGAACTTACTGATAACCATAAGTTATCCTCTTTAATATCTTTAGATATTTTG
ATGGCTTCTTTCTACAATGATTTCTACACAACTGAAGGATAATAAATTTAGCTTACAGAG
TATATGCTAACTAATTTCGAAAAATTTGACTCTTATAACAACTATTAGAATTATTATACA
AGTGTATTTTTCACTTTCATTAATGTTGTTATAGAAAAAATTGGAATTGAGCCTTTTTCA
ACTAATCTTATTGCAATAGAGAATCATTTCCGTAAATCGATTGAATATAATGCTAAACCT
AGAAAATTAAGCTCTAATGCCTTGATTTCTCTCTTGGTATTTTTGCGTAAAATTGTCAAC
ATCATTGAAGGATTCAGTTCAGATTTCAAAGAGTTTGTTATCCAAAATATTATGGACACA
TGCTTAATTAAACTGACTGAATTTGAATAAGACTAAAGCTAAAGGAATAACATAGATAAT
AATTTGATTATAGATGAATCTAATGATGTTGTGATTATTGAATTTGCAGAAACAATAAGC
AGATTTGTCACAATATTAAATGAATATTTTGATGAAAACTTATCATATGAGTTACTCAAC
TGTAGATATCCTTCTATATAAAAGAGTAGTTTCATACTATTAAAACAATTCTATCAAGCT
TTCTCACCAAAGGTAGATCTTACATTAAAGTGCTAAGCCTCGGATGAAGATTTTGAAGAT
AAGCTATTGCAAAACATTTATGATTAAAAAATGAATGTTGAAAATCTGTTAAAATATTTA
GATGTTACAAATGTTATCCTTACTGAAGAAGAAAAGCAAAAGCATATTGCTTAAATTAAG
AAATAATAAGGTATATAGAGTGATGATGAAGTTGAATTGTAAAAAGAAGAGAAAAAAACA
AATCAAGATAACAATTCCACAAATCCCTAGAGCGAAGAAACAGATAATATTAATTATTTA
AATCCTTTTGAAGAAAAAGAAGGTAAAGATGCTGATGAGGATGATGAAGATGAAAGTGAA
AATTAAGACATTATAGACCCTAAGACTTATGGTCATTTGCTAACTTGGATATCCTTTGTT
AACAAGCTTAACTCCCCTGAAACAGACGAAAACCATGAATTAGTTAAAAAAGCTTTAAAA
ATCTACCTAGATGAAAATAAGTTCATTTACAAGAACTTTTTAACTGTCTTATTCTAATGG
ATTGAATATTTAGAAATCCCCGAATCTTAATATAAAGATACCATTAGCATTGAAGATGTT
TAGAATGTAAATCCTGAATGGTCTGATTTCTTGTCCAAAGAAAGCTTGTTTTAACTATTG
GTCTAATCTTTATATATTTTCTCATCTAAATTCCCCTTCTTTTTACGTAACTGGTTGGAA
AATACAGCAGAAAAAAGATTCATTAAGGTTGCTGAAAGCTTAATCAAGAGCTTTATCAGC
AATGCTCTTTACTTGAAAGAAGTAGAAACCATTGAATTAAGTTAGATTGAATGGTAGTCT
GAAGAATTTAATATTTATGTTCTGAAAAAAACGAGAGAAATAAATGCAATATACATGAAA
GAGAACTAAAAATTAGAAATTAATTTGAAGATACCTTTAGAATATCCTATAAAACACATT
TAAACAGAAGTTAAAAGAGGCATGAAAGTTAATTTGCAAAAAACTAATAAATGGATGTTA
ATGATGAAGTCATTACTATTTAATTAGAACAATACAATTAAAAATGCTCTTTTAATGTGG
AAAGATAATTTAGATAAAGAGTTAGAAGGACTTGAAGAATGCGCTATTTGCTACTACGTC
ATTAACTCTACTTCAGGTGAATTACCTAAATTGCCTTGTAAAACTTGTAAGAAGAAATTC
CACTCTTCCTGTATCCACAAGTGGTTTAAGAGTTCTAATAAGAGTGAATGTCCTCTATGC
AAATCTCAATTTTTGTGA


>TTHERM_00218470(protein)
MDAVELKQKKKGGKDKSALSKQGQSTGLLSHVNENVNMFSQLSAMFLANKAEKSDQVKKF
LDKTEDKQVFQQHSYDPEIQQCLSQLNKKSQITKLKALNTLKELLQKQPEEFFEQFISTW
TYLYKQFVNSEYDRKVFEESNNVLIIIISKNRKCLQAQFKELFPYWFIQMNDPSADVSQI
ANQAFDKMFPKEKQAQAFNLCMEKYILNLKYYLSITQKQIESENNNLSEHESQEIYDRLV
VSSLNSIARAIQLNKDSKDPNIFISQLEEELFAQGKKSILIELLSKKRIKVRAAVIEVLQ
VLMNTISQEVLEQNIEVIAKNIMPLIDDKERQIQYSLWKGCLLTVLDKAPVAIIAKCDLK
MIEVKSLEVLKKAASGIGKQFYQNIIIFLSKLPMAAFTSILNKESVQQQNKFNPEEYIKE
RFSFIKKFFESILAGFTHDEIKFFGDQLVQSYFECIYFIVLKRISVVLDKEEVKSLKNVQ
KQARNLIRDLICNILNIYLEQNIADNVMNPYKQIPNSLGQLINNFNTESINSNETDLFDE
FVYEFSSIFSKTAKKDTTKYNNYILLLQSIANLVNKNSVLFNKLDSAVQKMHEDLLNDLK
GQIQPLMNDSHIEKILPICTQYKLYANLFNSSQQKSQKKQEQEQEEEQKSPEIQLGVFSN
LVTQQTVASLETINFSVQSIIQNIKTITNPTSLEKFTTFISQIYYSWSESLDEQHPQYSS
FQQILKDIQNHIKMLNQVDPKALLHLQFILHFALPETSPTYFSQFCTHVNKIKPIDDILI
LRNLSALESAQSQKNRVHMCTRLQNNQEYQTLAFGILSHIFGKMDRYLGVSLPLLVIIFK
NYLNRDNKIKLISQIQANISKKRESIFNGEIQEKNTSRVIDELELNYLFCIQIYKDLPKV
IDQNFDHLQFFNDFFKFIYFCFEKKLKSRIQQAFKIFKYLINDQAALTRIIENATCIFKF
ELNTIFIDKKQTKFDTLLKLIVDTFSFLKSHKKKDEILQLTSTILEPQYFENIIFEQRNW
RLLEALFEQITVSIDFNAYIQKLFVSQNGFWLISNLISSQQIFAILNSIQLKKYFKDLAN
NFIKPLIHKQIEEEFETALQFLNYMMKLAIEKSLIYGNSLKACLKQIMIDGIETHKQQQI
FNDIVKTKLDQLFVLENIDLMVREGILIKNLLPLFQEQLEKDSGSIEDLLRKKVSEVCRM
NAQELTDNHKLSSLISLDILMASFYNDFYTTEGQQIQLTEYMLTNFEKFDSYNNYQNYYT
SVFFTFINVVIEKIGIEPFSTNLIAIENHFRKSIEYNAKPRKLSSNALISLLVFLRKIVN
IIEGFSSDFKEFVIQNIMDTCLIKLTEFEQDQSQRNNIDNNLIIDESNDVVIIEFAETIS
RFVTILNEYFDENLSYELLNCRYPSIQKSSFILLKQFYQAFSPKVDLTLKCQASDEDFED
KLLQNIYDQKMNVENLLKYLDVTNVILTEEEKQKHIAQIKKQQGIQSDDEVELQKEEKKT
NQDNNSTNPQSEETDNINYLNPFEEKEGKDADEDDEDESENQDIIDPKTYGHLLTWISFV
NKLNSPETDENHELVKKALKIYLDENKFIYKNFLTVLFQWIEYLEIPESQYKDTISIEDV
QNVNPEWSDFLSKESLFQLLVQSLYIFSSKFPFFLRNWLENTAEKRFIKVAESLIKSFIS
NALYLKEVETIELSQIEWQSEEFNIYVLKKTREINAIYMKENQKLEINLKIPLEYPIKHI
QTEVKRGMKVNLQKTNKWMLMMKSLLFNQNNTIKNALLMWKDNLDKELEGLEECAICYYV
INSTSGELPKLPCKTCKKKFHSSCIHKWFKSSNKSECPLCKSQFL


>TTHERM_00218470(gene)
ATGGACGCAGTAGAATTAAAGTAAAAGAAAAAGGGAGGTAAAGATAAGTCAGCTCTTTCT
AAGCAAGGTTAGAGCACAGGTTTATTATCTCATGTAAATGAAAATGTTAACATGTTTTCA
CAATTATCAGCCATGTTTTTAGCAAACAAGGCTGAGAAATCAGACTAAGTAAAGAAGTTT
TTAGATAAGACAGAAGACAAACAAGTTTTTTAATAGCATTCTTACGATCCTGAAATATAA
TAATGTCTAAGTCAATTAAACAAAAAGAGTTAAATTACAAAGCTAAAAGCTTTAAACACT
CTCAAGGAACTTCTTTAGAAGTAACCTGAAGAGTTCTTTGAACAATTCATTTCTACATGG
ACTTATTTGTACAAGTAGTTTGTCAATTCAGAATATGATAGAAAAGTTTTTGAAGAAAGC
AATAATGTTTTAATTATTATCATTTCTAAAAACCGTAAATGTTTGCAAGCCTAGTTTAAG
GAACTCTTTCCTTATTGGTTTATATAAATGAATGATCCATCTGCTGATGTCTCATAAATT
GCTAATCAAGCTTTCGACAAGGTTTTTTCATTTTTGAATAAAATTTAACTATTTTTGGCA
ATTAAATAATTACTTTTTGTAATAAACATTTATATCTTAATTTTTAAAATAATGTTTGAG
TGATAGTTTAAAAAATGATTTTATCGATGCCAAATCAGATATTTAAAGGGAAATTCTTTT
TTTAACTTTTTTGTAATAAAAAATAGATGTTCCCTAAAGAAAAATAGGCCTAAGCGTTTA
ATTTATGCATGGAAAAGTACATTCTTAACTTAAAATATTACCTCAGTATAACGTAAAAGT
AGATTGAAAGCGAAAATAATAATTTAAGTGAGCATGAATCATAGGAAATATATGATAGAT
TAGTTGTTTCCTCTCTTAATTCTATAGCAAGAGCAATTTAGCTTAATAAGGATAGCAAAG
ATCCAAATATTTTTATTAGCTAATTGGAAGAAGAACTATTTGCACAGGGGAAAAAAAGCA
TACTCATAGAACTACTTTCTAAAAAGAGAATTAAAGTGCGTGCAGCTGTTATTGAAGTTT
TATAGGTTCTTATGAACACCATTTCATAAGAAGTTTTAGAATAAAATATTGAAGTTATAG
CAAAAAATATAATGCCACTTATTGATGATAAAGAAAGGTAAATTTAGTATTCTTTGTGGA
AAGGATGTCTTTTAACTGTTTTGGATAAAGCTCCTGTTGCAATAATTGCTAAGTGTGACC
TTAAAATGATTGAAGTCAAATCACTTGAAGTTCTTAAAAAAGCTGCTTCAGGTATCGGAA
AGCAATTTTACTAAAACATCATTATCTTTTTAAGTAAACTACCTATGGCTGCATTCACTT
CCATTTTAAACAAAGAGAGTGTTTAATAACAGAACAAGTTTAATCCTGAAGAATATATTA
AGGAAAGATTCTCATTTATCAAAAAGTTCTTTGAGTCTATTCTTGCAGGTTTTACTCATG
ACGAAATTAAATTTTTCGGAGATTAGCTTGTTTAGTCATACTTTGAATGTATTTATTTCA
TTGTTCTCAAAAGAATTTCTGTTGTTTTAGATAAAGAAGAAGTAAAATCCCTTAAAAATG
TTTAGAAATAAGCTCGTAACTTAATAAGAGATTTGATTTGCAATATATTAAATATCTATT
TAGAATAAAATATTGCTGATAATGTAATGAATCCCTATAAATAAATCCCTAACTCATTGG
GTTAACTAATTAACAATTTCAACACTGAATCAATCAATTCTAACGAAACAGATCTTTTTG
ATGAATTTGTTTATGAGTTTTCATCTATTTTTAGTAAGACAGCTAAGAAAGACACTACTA
AATACAATAATTACATACTTTTATTATAGAGCATTGCAAATTTAGTCAACAAGAATAGTG
TTTTGTTTAATAAATTAGATTCAGCTGTTCAAAAGATGCATGAAGATCTCCTTAATGATC
TAAAAGGTCAAATTCAACCTTTAATGAATGATTCTCATATTGAAAAAATTCTGCCTATTT
GCACTTAATACAAGCTATATGCAAATTTATTCAATTCCAGCTAATAAAAATCCCAAAAAA
AGCAAGAATAAGAATAAGAAGAAGAATAAAAATCACCCGAAATATAATTAGGAGTTTTCT
CAAACTTAGTTACTTAACAAACAGTAGCTTCTTTAGAAACAATTAATTTTTCAGTTTAAT
CAATTATTTAAAATATTAAAACAATAACAAATCCTACTTCTCTTGAAAAGTTTACAACTT
TTATTTCTTAAATTTATTATTCTTGGTCTGAATCACTAGATGAGCAACATCCTTAATATA
GCTCATTTTAGCAAATCCTAAAAGATATTTAGAATCACATTAAAATGTTGAATCAAGTAG
ATCCTAAAGCCCTCCTTCACTTATAATTTATACTTCATTTTGCTCTTCCTGAAACAAGTC
CTACTTACTTCTCCTAATTTTGCACTCATGTAAATAAAATAAAACCAATAGGTAACATAT
TTTTCTATTTAATTTAGCTTAATTTATAATTTATTTTGTCATTTATGAAATAAAAATTTA
AAAAAAAATAATTTAGACGACATATTGATACTAAGGAATCTTAGCGCCTTGGAGTCTGCT
TAATCTCAAAAAAATAGAGTTCACATGTGCACACGCCTATAAAATAACCAAGAATATTAG
ACCCTTGCTTTTGGAATTTTATCTCATATTTTTGGAAAAATGGATAGATATTTAGGTGTT
AGTTTACCTTTATTAGTTATCATTTTTAAAAATTACTTAAACAGAGATAATAAAATTAAG
TTGATTAGCTAGATTTAAGCCAACATTTCCAAGAAGAGAGAATCAATCTTTAATGGAGAA
ATCTAAGAAAAAAATACAAGCAGAGTAATTGATGAGCTTGAGCTAAATTACTTATTTTGC
ATATAAATTTACAAAGACCTCCCAAAAGTGATAGATCAAAACTTTGATCATTTACAATTT
TTTAATGATTTCTTTAAATTTATTTATTTCTGCTTTGAAAAGAAATTAAAATCTCGTATT
CAATAAGCATTTAAGATATTTAAATACCTCATAAATGACTAAGCTGCATTAACTAGGATT
ATAGAGAATGCTACATGCATTTTTAAATTTGAGCTGAATACTATCTTTATTGATAAAAAA
TAAACCAAATTCGATACTCTTCTTAAGTTGATAGTAGACACCTTCAGCTTCTTGAAAAGC
CATAAAAAGAAAGACGAAATACTTTAACTCACTTCAACAATCCTCGAGCCTCAATATTTT
GAAAATATAATATTCGAACAAAGAAATTGGAGATTATTAGAAGCTCTGTTCGAGTAAATT
ACTGTATCTATTGACTTTAATGCTTACATTTAGAAACTATTTGTCTCTTAAAATGGATTC
TGGTTGATTTCAAATTTGATTAGCAGTTAACAGATATTTGCTATACTTAATTCAATTCAA
CTTAAAAAATATTTTAAGGACTTGGCAAATAATTTTATCAAACCCCTCATTCATAAAGTA
ATTTTTTAATACAATTCCTTTTTTTACAAATTTATTTTAAAAAAGTAAATTGAAGAAGAG
TTTGAAACAGCCCTCCAATTCTTAAACTATATGATGAAATTGGCTATAGAAAAGAGTTTA
ATTTATGGTAACTCATTGAAGGCTTGCTTAAAATAAATCATGATTGATGGAATAGAGACT
CATAAACAATAACAAATATTCAATGATATAGTCAAAACAAAATTAGATTAACTTTTTGTA
TTGGAAAATATTGATCTGATGGTTCGTGAAGGTATTTTGATCAAAAATTTACTACCCCTA
TTTTAAGAATAGCTTGAAAAAGATTCAGGTAGCATCGAAGATTTGTTACGTAAAAAGGTT
AGCGAAGTTTGTAGAATGAATGCCTAAGAACTTACTGATAACCATAAGTTATCCTCTTTA
ATATCTTTAGATATTTTGATGGCTTCTTTCTACAATGATTTCTACACAACTGAAGGATAA
TAAATTTAGCTTACAGAGTATATGCTAACTAATTTCGAAAAATTTGACTCTTATAACAAC
TATTAGAATTATTATACAAGTGTATTTTTCACTTTCATTAATGTTGTTATAGAAAAAATT
GGAATTGAGCCTTTTTCAACTAATCTTATTGCAATAGAGAATCATTTCCGTAAATCGATT
GAATATAATGCTAAACCTAGAAAATTAAGCTCTAATGCCTTGATTTCTCTCTTGGTATTT
TTGCGTAAAATTGTCAACATCATTGAAGGATTCAGTTCAGATTTCAAAGAGTTTGTTATC
CAAAATATTATGGACACATGCTTAATTAAACTGACTGAATTTGAATAAGACTAAAGCTAA
AGGAATAACATAGATAATAATTTGATTATAGATGAATCTAATGATGTTGTGATTATTGAA
TTTGCAGAAACAATAAGCAGATTTGTCACAATATTAAATGAATATTTTGATGAAAACTTA
TCATATGAGTTACTCAACTGTAGATATCCTTCTATATAAAAGAGTAGTTTCATACTATTA
AAACAATTCTATCAAGCTTTCTCACCAAAGGTAGATCTTACATTAAAGTGCTAAGCCTCG
GATGAAGATTTTGAAGATAAGCTATTGCAAAACATTTATGATTAAAAAATGAATGTTGAA
AATCTGTTAAAATATTTAGATGTTACAAATGTTATCCTTACTGAAGAAGAAAAGCAAAAG
CATATTGCTTAAATTAAGAAATAATAAGGTATATAGAGTGATGATGAAGTTGAATTGTAA
AAAGAAGAGAAAAAAACAAATCAAGATAACAATTCCACAAATCCCTAGAGCGAAGAAACA
GATAATATTAATTATTTAAATCCTTTTGAAGAAAAAGAAGGTAAAGATGCTGATGAGGAT
GATGAAGATGAAAGTGAAAATTAAGACATTATAGACCCTAAGACTTATGGTCATTTGCTA
ACTTGGATATCCTTTGTTAACAAGCTTAACTCCCCTGAAACAGACGAAAACCATGAATTA
GTTAAAAAAGCTTTAAAAATCTACCTAGATGAAAATAAGTTCATTTACAAGAACTTTTTA
ACTGTCTTATTCTAATGGATTGAATATTTAGAAATCCCCGAATCTTAATATAAAGATACC
ATTAGCATTGAAGATGTTTAGAATGTAAATCCTGAATGGTAAATAAATATATATTAATTA
TTTAAATTTATTTTAATTATTTCTTTTTCTTGAAAAATATTTTTGCTTTCATACATTAAT
TATTTCTCAAAACAATAAAAAAATGATTCAAAAATTAATAAAATATTTCCCAAAATTCAT
AAAAAAATACTTTAAATTAAAATTTACTTGTTTATTTAAAATATAAATAATATTAAAAAG
GTCTGATTTCTTGTCCAAAGAAAGCTTGTTTTAACTATTGGTCTAATCTTTATATATTTT
CTCATCTAAATTCCCCTTCTTTTTACGTAACTGGTTGGAAAATACAGCAGAAAAAAGATT
CATTAAGGTTGCTGAAAGCTTAATCAAGAGCTTTATCAGCAATGCTCTTTACTTGAAAGA
AGTAGAAACCATTGAATTAAGTTAGATTGGTAATTTTTTTAGTTGTTTTGAAATTTATTT
AATTAATTAAAATTATTTTTTTTATTTATAGAATGGTAGTCTGAAGAATTTAATATTTAT
GTTCTGAAAAAAACGAGAGAAATAAATGCAATATACATGAAAGAGAACTAAAAATTAGAA
ATTAATTTGAAGATACCTTTAGAATATCCTATAAAGTAATTTCTTAAAATATGATGCAGA
TTATTAAAAATTCAAAAATTTATTTGATTTTCATTAATTTTTATCTATTTTTTACTAACA
ATTTTCTTTAAATAGACACATTTAAACAGAAGTTAAAAGAGGCATGAAAGTTAATTTGCA
AAAAACTAATAAATGGATGTTAATGATGAAGTCATTACTATTTAATTAGAACAATACAAT
TAAAAATGCTCTTTTAATGTGGAAAGATAATTTAGATAAAGAGTTAGAAGGACTTGAAGA
ATGCGCTATTTGCTACTACGTCATTAACTCTACTTCAGGTGAATTACCTAAATTGCCTTG
TAAAACTTGTAAGAAGAAATTCCACTCTTCCTGTATCCACAAGTGGTTTAAGAGTTCTAA
TAAGAGTGAATGTCCTCTATGCAAATCTCAATTTTTGTGA