Identifiers and Description

Gene Model Identifier

TTHERM_00216010

Standard Name

FTT18 (Fourteen-Three-Three 18)

Aliases

18.m00476 | PreTt22226 | PreTt22225 | 3701.m00014

Description

FTT18 Bmh1 14-3-3 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00216010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06568.13.0002313851495736e-15514-3-3 family protein (245 aa)
SGDYER177W6.00054123732624e-104BMH1 14-3-3 protein, major iso
form; controls proteome at pos
t-transcriptional level, binds
proteins and DNA, involved in
regulation of many processes
including exocytosis, vesicle
transport, Ras/MAPK signaling,
and rapamycin-sensitive signa
ling
OxytrichaContig938.1.g1389.99679536751975e-10314-3-3 protein
DictyBaseDDB_G02691381.9998944264638884e-101fttB on chromosome: 1 position
3949672 to 3950633
WormBaseWBGene000015023.9981372112117256e-92locus:ftt-2 14-3-3-like prot
ein 2 status:Confirmed Uni
Prot:Q20655 protein_id:CAA91
474.1
Stentor CoeruleusSteCoe_29433.0144087850653746e-40

General Information

Paragraph NoGene NameParagraph Text
134FTT18Ftt18p localizes to the conjugation junction and the periphery of the selected haploid micronucleus during sexual reproduction. It interacts (CoIP) with Semi1p.

Associated Literature

  1. Ref:31884169: Akematsu T, Sánchez-Fernández R, Kosta F, Holzer E, Loidl J (2019) The Transmembrane Protein Semi1 Positions Gamete Nuclei for Reciprocal Fertilization in Tetrahymena. iScience 23(1):100749

Sequences

>TTHERM_00216010(coding)
ATGTCTTTATCTAGAGAAGAAAATATTTACATGGGTAAGATTTCGGAACAAACCGAAAGA
TTCGAAGATATGTTAGAATACATGAAGAAGGTTGTTCAAACTGGTTAGGAATTATCCGTT
GAAGAAAGAAACCTTCTCTCTGTTGCTTACAAGAACACCGTTGGTTCTCGTAGATCTGCC
TGGAGAAGTATCTCTGCCATCCAACAAAAGGAAGAATCCAAGGGATCTAAGCACCTCGAC
CTCCTCACCAACTATAAGAAGAAGATCGAAACTGAACTTAACCTTTACTGCGAAGATATC
CTCAGACTCCTCAACGATTACCTCATCAAGAATGCCACCAACGCTGAAGCTCAAGTTTTC
TTCTTGAAGATGAAGGGTGATTACTACAGATATATTGCTGAATACGCCTAAGGTGACGAC
CACAAGAAGGCTGCCGATGGTGCCTTGGACTCCTACAATAAGGCTTCTGAAATCGCCAAC
TCTGAATTGAGCACCACTCACCCCATCAGATTAGGTTTGGCTCTTAACTTCTCCGTTTTC
CACTACGAAGTCTTGAATGACCCCTCCAAAGCCTGCACCTTGGCTAAGACTGCTTTCGAT
GAAGCTATTGGTGATATCGAAAGAATCTAAGAAGACTAATATAAGGATGCCACCACCATT
ATGCAATTAATTAGAGATAACCTCACCCTCTGGACTTCTGAATTCCAAGACGATGCTGAA
GAATAATAAGAATGA


>TTHERM_00216010(protein)
MSLSREENIYMGKISEQTERFEDMLEYMKKVVQTGQELSVEERNLLSVAYKNTVGSRRSA
WRSISAIQQKEESKGSKHLDLLTNYKKKIETELNLYCEDILRLLNDYLIKNATNAEAQVF
FLKMKGDYYRYIAEYAQGDDHKKAADGALDSYNKASEIANSELSTTHPIRLGLALNFSVF
HYEVLNDPSKACTLAKTAFDEAIGDIERIQEDQYKDATTIMQLIRDNLTLWTSEFQDDAE
EQQE


>TTHERM_00216010(gene)
ATGTCTTTATCTAGAGAAGAAAATATTTACATGGGTAAGATTTCGGAACAAACCGAAAGA
TTCGAAGATATGTTAGAATACATGAAGAAGGTTGTTCAAACTGGTTAGGAATTATCCGTT
GAAGAAAGAAACCTTCTCTCTGTTGCTTACAAGAACACCGTTGGTTCTCGTAGATCTGCC
TGGAGAAGTATCTCTGCCATCCAACAAAAGGAAGAATCCAAGGGATCTAAGCACCTCGAC
CTCCTCACCAACTATAAGAAGAAGATCGAAACTGAACTTAACCTTTACTGCGAAGATATC
CTCAGACTCCTCAACGATTACCTCATCAAGAATGCCACCGTAAGCTACATTTTATTCTAT
TGGCTTTCTACTCATTTTTCATATATTTTTATTCACTCATCCAACCATCTTCTACACATA
AGTATGTCTTCTTAACATAAGTGTTTTCATTCAAATCAGTAAAGATTGACTCCAATTTTA
AGTGGAGCCCATAGTCCTTTATTTGAATTAAATAACTTATCGCTACCCTCAAATGAGAGT
AAGACGTCTTTTAATTTTTTCTTCATACCTTATTTTTGAAGAACAAAATTTAAAAAGAAA
TTAAGAAGCAAGTAAGAAGATAAATAGGAGCTTTATAGTAAAATGGAGTTGATTTAATTG
ATACTACATACCCAATACTCATTAATTTATGAGATTGTTAGTATCTTCAAATAAGCTTAC
AATTTTACTTATGTGTGTCTGAATATGACTAACATTTTTTGTAGTAAGCGGTCAACTACA
TTACTCTAAGTTAGGAAAATAAATCAATAAAACAAAGAGGATTGTATCTTTTCTTTAAGA
TAGTAAATAATCTTAATTGAATAGAATGCCTCAAAAATACTCTCCTAACAGTTTTAAATA
CTTTTTTCTTTTTTTCTCTTAGCTTCATCAATTTCAAAATAAAATAAAATAAATACGAAA
GAAGTCAATCAACTTACTTGACCTTTCTTTTCATAAATTATATCATCATCAAAGATGATT
TAGTTACTGAGTGAGTGAGTGAGTGAATACGATTTAACCCAATATACTTCTTCTCAAAAA
TTATTGTTTTAATTATCTTCTACTGCTACTGTACCCTATAGCTAGATGCTTAGCCAGTCA
GTAAGTCAGTTAGTTAGTGAGGAAAAATCATGTTTTTATAGCAAAAAAAGTAAAGATGCT
TACATGCAAACTTTATTTAATCAAATAAAAAGAGAAGTATATTCGGCCATTAATGATTAA
TAAATTAGAGAAAGCACATACAATATATTATTCATCCATACTAATCTTCTTTTTAAATAA
ATAGAACGCTGAAGCTCAAGTTTTCTTCTTGAAGATGAAGGGTGATTACTACAGATATAT
TGCTGAATACGCCTAAGGTGACGACCACAAGAAGGCTGCCGATGGTGCCTTGGACTCCTA
CAATAAGGCTTCTGAAATCGCCAACTCTGAATTGAGCACCACTCACCCCATCAGATTAGG
TTTGGCTCTTAACTTCTCCGTTTTCCACTACGAAGTCTTGAATGACCCCTCCAAAGCCTG
CACCTTGGCTAAGACTGCTTTCGATGAAGCTATTGGTGATATCGAAAGAATCTAAGAAGA
CTAATATAAGGATGCCACCACCATTATGCAATTAATTAGAGATAACCTCACCCTCTGGAC
TTCTGAATTCCAAGACGATGCTGAAGAATAATAAGAATGA