Identifiers and Description

Gene Model Identifier

TTHERM_00205170

Standard Name

None

Aliases

PreTt13791 | 17.m00398

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07716 ) Basic region leucine zipper
  • ( PF02183 ) Homeobox associated leucine zipper
  • ( TIGR00073 ) hydrogenase accessory protein HypB

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00205170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16718.12.9992439173235726e-110hypothetical protein (155 aa)
OxytrichaContig3891.0.g691.0001801308941382e-55Nnf1
Stentor CoeruleusSteCoe_273688.75651076269652e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00205170(coding)
ATGAACAGCTCATTAAAATACGGAAAGGGTTCTAGACCTGAAGATGACTATCAACAATAC
AATAACACTCAAAAGGGATTCAACAATACTCAATCCTCTTTTGGCACCAACCCTGCTTCT
CTTAAGGGCAAGCTTATGTCATTAGAAGAAATGATTAAAAACATAGCTGACGAAATGAAT
TTCCACAAGAAGGAAGTTTAAATCTTGAAGAGTGAAAAGGACACATTATAATCTGTCCTT
TCTATGAAAACCCAAGATGTTAAGAAGACTTTGACAAGCGAATTAATGAGAATCGAAGAA
GAAATGAAGAGACATTTCGCTCATCAAAAGGCTGAAAATGCTCGTTTACAATAGTAAATT
ACTTCTTTGAAGGGTGAAAAGACCGCTCTTCAATAATAACTTTTGGGATTGCAAAGAAGA
ATTACTGAACTCGAAATGCAAGTTGGTAACGAAGATAACCATTGA


>TTHERM_00205170(protein)
MNSSLKYGKGSRPEDDYQQYNNTQKGFNNTQSSFGTNPASLKGKLMSLEEMIKNIADEMN
FHKKEVQILKSEKDTLQSVLSMKTQDVKKTLTSELMRIEEEMKRHFAHQKAENARLQQQI
TSLKGEKTALQQQLLGLQRRITELEMQVGNEDNH


>TTHERM_00205170(gene)
ATGAACAGCTCATTAAAATACGGAAAGGGTTCTAGACCTGAAGATGACTATCAACAATAC
AATAACACTCAAAAGGGATTCAACAATACTCAATCCTCTTTTGGCACCAACCCTGCTTCT
CTTAAGGGCAAGCTTATGTCATTAGAAGTAATAAATTAATTGAAATTTTCACATTTATAA
TAGCGATAATAAACAGATAGTTGATTGTAGTTGGTACTTAAAATATTTTTACAAACAAAC
AAACAATTAAATAAAACGAAGCAATTCTTGTTTATTAAACTCAATATAGAAAAATATAAA
ACTAATAAAATGTTTTTTAAAACAGGAAATGATTAAAAACATAGCTGACGAAATGAATTT
CCACAAGAAGGAAGTTTAAATCTTGAAGAGTGAAAAGGACACATTATAATCTGTCCTTTC
TATGAAAACCCAAGATGTTAAGAAGACTTTGACAAGCGAATTAATGAGAATCGAAGAAGA
AATGAAGAGACATTTCGCTCATCAAAAGGCTGAAAATGCTCGTTTACAATAGTAAATTAC
TTCTTTGAAGGGTGAAAAGACCGCTCTTCAATAATAACTTTTGGGATTGCAAAGAAGAAT
TACTGAACTCGAAATGCAAGTTGGTAACGAAGATAACCATTGA