Identifiers and Description

Gene Model Identifier

TTHERM_00196200

Standard Name

None

Aliases

PreTt06805 | 16.m00461

Description

isocitrate dehydrogenase, NADP-dependent family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00175 ) isocitrate dehydrogenase, NAD-dependent
  • ( TIGR00127 ) isocitrate dehydrogenase, NADP-dependent
  • ( TIGR00183 ) isocitrate dehydrogenase, NADP-dependent
  • ( TIGR02088 ) isopropylmalate/isohomocitrate dehydrogenases
  • ( PF00180 ) dehydrogenase, isocitrate/isopropylmalate family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000079429.997093137033517e-262locus:idh-2 Isocitrate dehyd
rogenase [NADP] status:Confi
rmed UniProt:O17643 protei
n_id:CAB03943.1
Tetrahymena borealisEI9_03798.19.997093137033517e-262isocitrate dehydrogenase, NADP
-dependent family protein (429
aa)
DictyBaseDDB_G02722109.997093137033517e-262idhM on chromosome: 2 position
1672253 to 1673699
OxytrichaContig13323.0.g139.997093137033517e-262Isocitrate/isopropylmalate deh
ydrogenase
SGDYLR174W9.997093137033517e-262IDP2 Cytosolic NADP-specific i
socitrate dehydrogenase, catal
yzes oxidation of isocitrate t
o alpha-ketoglutarate; levels
are elevated during growth on
non-fermentable carbon sources
and reduced during growth on
glucose

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00196200(coding)
ATGATGAATTAAACTATCAAGAACGCTGCCTCTAAATACAAATACGCAGGAAACAAGATC
AATGTTAAGAATCCTATTGTCGATTTAGATGGTGATGAAATGACTCGTATCATTTGGAAA
ATGATTAAGGATAAACTCATATTGCCATTTATCTCAGCTGATATTAGATATTATGATCTT
TCTATAGAAAATCGTGATGCCACCAATGATTAAGTTACCTTTGATGCTGCTTATGCTATA
CGTGAACACAAGGTTGGTATTAAGTGTGCCACTATTACTGCAGATGAAGCACGTGTTAAA
GAGTTCAAACTTAAAAAAATGTGGCCTTCTCCTAATGGTACTATTCGTAACATTTTGGAT
GGTACAGTTTTCCGTGAACCTATTGTATGCCAAAATATCCCTCGTTTAGTTCCAGGATGG
ACCAAGCCAATTATTATTGGTCGTCACTCTTTTGGTGATCAATACAAGTGTACAAATTTC
AAGGTTCAAGGACCTGGAAAACTTGAAATATCTTTCAAGCCTTAAGATGGAGGTGAAGAA
ATTCGTAAAACCGTTTTTGAATTTTCAGGAAAAGGTGGTGTCGCAATGGGTATGTACAAT
ACTATTGAAAGTATTGAATCATTTGCCAATAGTTGCTTCAAATATGCCCTCAACCGTTAA
TACCCATTATATTTCTCTTCAAAGAACACCATCCTTAAGCAATATGACGGACTTTTCAAA
GACATTTTCGAAGAATTATATACAACTAAGTACAAATAGCAATTTGAAAAGAGTGGTTTG
TGGTATGAACATCGTCTTATTGATGATATGGTTGCTTAAGTATTAAAAGGTGATGGTGGT
ATTGTTTGGGCTTGCAAAAACTATGATGGTGATGTTCAAAGTGATATTATCGCCTAAGGC
TATGGTTCTTTGGGTATGATGACAAGTGAACTTGTTAACAATGATAATGTCTATGAAGCT
GAAGCTGCTCATGGAACTGTAACCAGACACTATCGTCAACATTAAAAAGGTTAGGAAACT
TCTACAAACTCTGTAGCAAGTATTTATGCTTGGAGTAGAGGTCTTCGTCATAGAGCCAAA
TTAGATAACAACTAGGATTTACTTACATTCTCATAATGTATTGAAGAATCTGTATTAGAT
TGTATTTCTAATGGTAAAATGACTAAAGATCTTGCAATTTTAGTATACGGACAAGATAAC
ATCAAAGGAAAATACCTCAACACAGAGGAATTTATTGATGCAGTCGCCTATAGATTAAAG
AGCTAAATCCACATTGAAAAGTGA


>TTHERM_00196200(protein)
MMNQTIKNAASKYKYAGNKINVKNPIVDLDGDEMTRIIWKMIKDKLILPFISADIRYYDL
SIENRDATNDQVTFDAAYAIREHKVGIKCATITADEARVKEFKLKKMWPSPNGTIRNILD
GTVFREPIVCQNIPRLVPGWTKPIIIGRHSFGDQYKCTNFKVQGPGKLEISFKPQDGGEE
IRKTVFEFSGKGGVAMGMYNTIESIESFANSCFKYALNRQYPLYFSSKNTILKQYDGLFK
DIFEELYTTKYKQQFEKSGLWYEHRLIDDMVAQVLKGDGGIVWACKNYDGDVQSDIIAQG
YGSLGMMTSELVNNDNVYEAEAAHGTVTRHYRQHQKGQETSTNSVASIYAWSRGLRHRAK
LDNNQDLLTFSQCIEESVLDCISNGKMTKDLAILVYGQDNIKGKYLNTEEFIDAVAYRLK
SQIHIEK


>TTHERM_00196200(gene)
ATAAAAAACAAAAAATAGATACATTCATAAAATAAAAAAGCAATTAACTTTGGATATTAT
ATCTCTAGTCTAGTTAGTTAGTTAGGTTAAAAATAAAATGATGAATTAAACTATCAAGAA
CGCTGCCTCTAAATACAAATACGCAGGAAACAAGATCAATGTTAAGAATCCTATTGTCGA
TTTAGATGGTGATGAAATGACTCGTATCATTTGGAAAATGATTAAGGATAAACTCATATT
GCCATTTATCTCAGCTGATATTAGATATTATGATCTTTCTATAGAAAATCGTGATGCCAC
CAATGATTAAGTTACCTTTGATGCTGCTTATGCTATACGTGAACACAAGGTTGGTATTAA
GTGTGCCACTATTACTGCAGATGAAGCACGTGTTAAAGAGTTCAAACTTAAAAAAATGTG
GCCTTCTCCTAATGGTACTATTCGTAACATTTTGGATGGTACAGTTTTCCGTGAACCTAT
TGTATGCCAAAATATCCCTCGTTTAGTTCCAGGATGGACCAAGCCAATTATTATTGGTCG
TCACTCTTTTGGTGATCAATACAAGTGTACAAATTTCAAGGTTCAAGGACCTGGAAAACT
TGAAATATCTTTCAAGCCTTAAGATGGAGGTGAAGAAATTCGTAAAACCGTTTTTGAATT
TTCAGGAAAAGGTGGTGTCGCAATGGGTATGTACAATACTATTGAAAGTATTGAATCATT
TGCCAATAGTTGCTTCAAATATGCCCTCAACCGTTAATACCCATTATATTTCTCTTCAAA
GAACACCATCCTTAAGCAATATGACGGACTTTTCAAAGACATTTTCGAAGAATTATATAC
AACTAAGTACAAATAGCAATTTGAAAAGAGTGGTTTGTGGTATGAACATCGTCTTATTGA
TGATATGGTTGCTTAAGTATTAAAAGGTGATGGTGGTATTGTTTGGGCTTGCAAAAACTA
TGATGGTGATGTTCAAAGTGATATTATCGCCTAAGGCTATGGTTCTTTGGGTATGATGAC
AAGTGAACTTGTTAACAATGATAATGTCTATGAAGCTGAAGCTGCTCATGGAACTGTAAC
CAGACACTATCGTCAACATTAAAAAGGTTAGGAAACTTCTACAAACTCTGTAGCAAGTAT
TTATGCTTGGAGTAGAGGTCTTCGTCATAGAGCCAAATTAGATAACAACTAGGATTTACT
TACATTCTCATAATGTATTGAAGAATCTGTATTAGATTGTATTTCTAATGGTAAAATGAC
TAAAGATCTTGCAATTTTAGTATACGGACAAGATAACATCAAAGGAAAATACCTCAACAC
AGAGGAATTTATTGATGCAGTCGCCTATAGATTAAAGAGCTAAATCCACATTGAAAAGTG
AAAATAAGCTATTTGAGAAAATAACTTTAATTCTTCTATACTATAATCTGTATTTTAATA
TCAAAATATATTTTTTATACAAATTATTTATTCTAAATAAATAAATTAATTAATAAATTA
GTTAGTTAGTTAACTTATCAGATA