Identifiers and Description

Gene Model Identifier

TTHERM_00196200

Standard Name

None

Aliases

PreTt06805 | 16.m00461

Description

isocitrate dehydrogenase, NADP-dependent family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00175 ) isocitrate dehydrogenase, NAD-dependent
  • ( TIGR00127 ) isocitrate dehydrogenase, NADP-dependent
  • ( TIGR00183 ) isocitrate dehydrogenase, NADP-dependent
  • ( TIGR02088 ) isopropylmalate/isohomocitrate dehydrogenases
  • ( PF00180 ) dehydrogenase, isocitrate/isopropylmalate family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig13323.0.g139.99709313703352e-262Isocitrate/isopropylmalate deh
ydrogenase
Tetrahymena borealisEI9_03798.19.99709313703352e-262isocitrate dehydrogenase, ...
ParameciumDBGSPATP000052180011.00022111241167e-173Paramecium tetraurelia GSPATP0
0005218001 protein
ParameciumDBGSPATP000091940011.00022111241167e-173Paramecium tetraurelia GSPATP0
0009194001 protein
TAIRAT5G145909.9985960992081e-158isocitrate dehydrogenase, puta
tive / NADP+ isocitrate dehydr
ogenase, putative
WormBaseC34F6.89.99689462303885e-156WBGene00007942 Isocitrate and
isopropylmalate dehydrogenases
DictyBaseDDB01687921.00010432652466e-154idhM isocitrate dehydrogenase
(NADP+), mitochondrial isocitr
ate dehydrogenase (NADP+)
DictyBaseDDB02314021.00010432652466e-154idhM isocitrate dehydrogenase
(NADP+), mitochondrial isocitr
ate dehydrogenase (NADP+)
ToxoDB583.m006749.99519343641294e-154Toxoplasma gondii isocitrate d
ehydrogenase, putative
IPI(HUMAN)IPI:IPI00011107.29.99934137263994e-153 PROT:P48735|TREMBL:Q53GL5|ENS
EMBL:ENSP00000331897|REFSEQ :N
P_002159|H-INV:HIT000034224 Ta
x_Id=9606 Isocitrate dehydroge
nase [NADP], mitochondrial pre
cursor
PlasmoDBPF13_02421.00025342324882e-144Plasmodium falciparum 0242
SGDYLR174W1.00008320861615e-142IDP2 SGDID:S000004164, Chr XII
from 504593-505831, Verified
ORF, "Cytosolic NADP-specific
isocitrate dehydrogenase, cata
lyzes oxidation of isocitrate
to alpha-ketoglutarate; levels
are elevated during growth on
non-fermentable carbon source
s and reduced during growth on
glucose"
FlyBaseFBgn00012481.00049823623892e-141

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00196200(coding)
ATGATGAATTAAACTATCAAGAACGCTGCCTCTAAATACAAATACGCAGGAAACAAGATC
AATGTTAAGAATCCTATTGTCGATTTAGATGGTGATGAAATGACTCGTATCATTTGGAAA
ATGATTAAGGATAAACTCATATTGCCATTTATCTCAGCTGATATTAGATATTATGATCTT
TCTATAGAAAATCGTGATGCCACCAATGATTAAGTTACCTTTGATGCTGCTTATGCTATA
CGTGAACACAAGGTTGGTATTAAGTGTGCCACTATTACTGCAGATGAAGCACGTGTTAAA
GAGTTCAAACTTAAAAAAATGTGGCCTTCTCCTAATGGTACTATTCGTAACATTTTGGAT
GGTACAGTTTTCCGTGAACCTATTGTATGCCAAAATATCCCTCGTTTAGTTCCAGGATGG
ACCAAGCCAATTATTATTGGTCGTCACTCTTTTGGTGATCAATACAAGTGTACAAATTTC
AAGGTTCAAGGACCTGGAAAACTTGAAATATCTTTCAAGCCTTAAGATGGAGGTGAAGAA
ATTCGTAAAACCGTTTTTGAATTTTCAGGAAAAGGTGGTGTCGCAATGGGTATGTACAAT
ACTATTGAAAGTATTGAATCATTTGCCAATAGTTGCTTCAAATATGCCCTCAACCGTTAA
TACCCATTATATTTCTCTTCAAAGAACACCATCCTTAAGCAATATGACGGACTTTTCAAA
GACATTTTCGAAGAATTATATACAACTAAGTACAAATAGCAATTTGAAAAGAGTGGTTTG
TGGTATGAACATCGTCTTATTGATGATATGGTTGCTTAAGTATTAAAAGGTGATGGTGGT
ATTGTTTGGGCTTGCAAAAACTATGATGGTGATGTTCAAAGTGATATTATCGCCTAAGGC
TATGGTTCTTTGGGTATGATGACAAGTGAACTTGTTAACAATGATAATGTCTATGAAGCT
GAAGCTGCTCATGGAACTGTAACCAGACACTATCGTCAACATTAAAAAGGTTAGGAAACT
TCTACAAACTCTGTAGCAAGTATTTATGCTTGGAGTAGAGGTCTTCGTCATAGAGCCAAA
TTAGATAACAACTAGGATTTACTTACATTCTCATAATGTATTGAAGAATCTGTATTAGAT
TGTATTTCTAATGGTAAAATGACTAAAGATCTTGCAATTTTAGTATACGGACAAGATAAC
ATCAAAGGAAAATACCTCAACACAGAGGAATTTATTGATGCAGTCGCCTATAGATTAAAG
AGCTAAATCCACATTGAAAAGTGA


>TTHERM_00196200(protein)
MMNQTIKNAASKYKYAGNKINVKNPIVDLDGDEMTRIIWKMIKDKLILPFISADIRYYDL
SIENRDATNDQVTFDAAYAIREHKVGIKCATITADEARVKEFKLKKMWPSPNGTIRNILD
GTVFREPIVCQNIPRLVPGWTKPIIIGRHSFGDQYKCTNFKVQGPGKLEISFKPQDGGEE
IRKTVFEFSGKGGVAMGMYNTIESIESFANSCFKYALNRQYPLYFSSKNTILKQYDGLFK
DIFEELYTTKYKQQFEKSGLWYEHRLIDDMVAQVLKGDGGIVWACKNYDGDVQSDIIAQG
YGSLGMMTSELVNNDNVYEAEAAHGTVTRHYRQHQKGQETSTNSVASIYAWSRGLRHRAK
LDNNQDLLTFSQCIEESVLDCISNGKMTKDLAILVYGQDNIKGKYLNTEEFIDAVAYRLK
SQIHIEK


>TTHERM_00196200(gene)
ATGATGAATTAAACTATCAAGAACGCTGCCTCTAAATACAAATACGCAGGAAACAAGATC
AATGTTAAGAATCCTATTGTCGATTTAGATGGTGATGAAATGACTCGTATCATTTGGAAA
ATGATTAAGGATAAACTCATATTGCCATTTATCTCAGCTGATATTAGATATTATGATCTT
TCTATAGAAAATCGTGATGCCACCAATGATTAAGTTACCTTTGATGCTGCTTATGCTATA
CGTGAACACAAGGTTGGTATTAAGTGTGCCACTATTACTGCAGATGAAGCACGTGTTAAA
GAGTTCAAACTTAAAAAAATGTGGCCTTCTCCTAATGGTACTATTCGTAACATTTTGGAT
GGTACAGTTTTCCGTGAACCTATTGTATGCCAAAATATCCCTCGTTTAGTTCCAGGATGG
ACCAAGCCAATTATTATTGGTCGTCACTCTTTTGGTGATCAATACAAGTGTACAAATTTC
AAGGTTCAAGGACCTGGAAAACTTGAAATATCTTTCAAGCCTTAAGATGGAGGTGAAGAA
ATTCGTAAAACCGTTTTTGAATTTTCAGGAAAAGGTGGTGTCGCAATGGGTATGTACAAT
ACTATTGAAAGTATTGAATCATTTGCCAATAGTTGCTTCAAATATGCCCTCAACCGTTAA
TACCCATTATATTTCTCTTCAAAGAACACCATCCTTAAGCAATATGACGGACTTTTCAAA
GACATTTTCGAAGAATTATATACAACTAAGTACAAATAGCAATTTGAAAAGAGTGGTTTG
TGGTATGAACATCGTCTTATTGATGATATGGTTGCTTAAGTATTAAAAGGTGATGGTGGT
ATTGTTTGGGCTTGCAAAAACTATGATGGTGATGTTCAAAGTGATATTATCGCCTAAGGC
TATGGTTCTTTGGGTATGATGACAAGTGAACTTGTTAACAATGATAATGTCTATGAAGCT
GAAGCTGCTCATGGAACTGTAACCAGACACTATCGTCAACATTAAAAAGGTTAGGAAACT
TCTACAAACTCTGTAGCAAGTATTTATGCTTGGAGTAGAGGTCTTCGTCATAGAGCCAAA
TTAGATAACAACTAGGATTTACTTACATTCTCATAATGTATTGAAGAATCTGTATTAGAT
TGTATTTCTAATGGTAAAATGACTAAAGATCTTGCAATTTTAGTATACGGACAAGATAAC
ATCAAAGGAAAATACCTCAACACAGAGGAATTTATTGATGCAGTCGCCTATAGATTAAAG
AGCTAAATCCACATTGAAAAGTGA