Identifiers and Description

Gene Model Identifier

TTHERM_00196050

Standard Name

None

Aliases

PreTt06790 | 16.m00446

Description

tubulin glycylase 3C; Tubulin-tyrosine ligase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04758 ) Ribosomal protein S30
  • ( PF03133 ) Tubulin-tyrosine ligase family
  • ( PF07200 ) Modifier of rudimentary (Mod(r)) protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00196050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03784.19.997093137033517e-262tubulin-tyrosine ligase (1040
aa)
OxytrichaContig15566.0.g282.9987968531770536e-120Tubulin-tyrosine ligase family
Stentor CoeruleusSteCoe_66331.5007857627073948e-41
WormBaseWBGene000441875.998312950603665e-35locus:ttll-9 status:Partiall
y_confirmed UniProt:Q564U4
protein_id:CAI79169.1
DictyBaseDDB_G02815414.001714826231863e-32DDB_G0281541 on chromosome: 3
position 4627625 to 4629265
SGDYBR094W0.00000000039982266684865623PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00196050(coding)
ATGAAAGATGTAGCTGCCACCAAGTAAAAATTTGACACTAAAAATAAACTTCAACAATTA
GAATTAGAAAACGAAAATTCACAAAACAACTCGTACAAAACCTCTAACAACTTATCTAAA
GAAGAGGTCATTGCAGTTTTATAAAAACAAAATAGAAAGAAAAATGTTAATTTCGTGCAG
AATGATAATTAAAAGCTCATAGATAGACATAAAGAATATTTAAAGCAGCTTAAACAGTAA
GTAACAATAGAAAAAGAAACATAAAAGCAGCTTAAGAAGAAAGATGAAGAAAACAAAATT
AGATTAAGAAACTCTGTCTTAGCTTCAATCAAAAACGATTTAACCGAACAAAGAAAATTA
ATATAGGAAAATCATAATTTATTTTTATCAAAGAGCACAGTATCATAAAGTGCAAAGCAA
ATATCCCTTCCTGAAATAAACTAGTCTTTAACTATTTGTTTGGAAAAGCAAAAGAGTGAA
GTTGAGCAGGAAAAGAAGGCCGTTTTGACTAGTTAAGCTTTTTTCAGATAAAGCTCTTTG
AGGGAAATAGAAGAAACAAATGAAAAAATAGAATCAAAGACTAATTTGTCTAAAGTAAAA
AAACTTAGACCTTTGCCATTTATAAGCTCTATGGTTGAATGGAAAAAAAAGCAAAGAATT
CCTGCTGATTCTAAAATATTTATAGTTATGGGAGGATACAAAGATTTTAAGAAAGCTCTT
TTAAAGAGAGGGTGGATAGAAAACCCATAAACTAATAGTCCTTGTTTTGATCTGAAATGG
ACTTTGTTAGGAAAAGATATTGACTATGATAATATTTTACCTAATTAAATAGTAAATCAT
TTTGAAAATAATTCGAAAATATGCTCAAAAATAGGATTGCTAAATAGTCTTAAAAATTTA
TATTGGTTTGACAATGCAGACCTAAATTGTTTTTTTCCTTAATGTTTCGATATGAATGAT
CCTGATGAATTTAATGACTTCGTCAAAAATTTTAAGCTCAGCAAAGCTGTTTCAGTTTTG
AAAAAGTATTTAAGATTATATCTTGAAAAAGATGAAAAATATAACAACTGTAAAATACAG
GCTTAAGTAGCTCTTTAGGTTCTTACACGTTATTATAATGATATTAATAATGTAATAGAT
GACGAAAAATAAGCATCCGAATATTTTAAAAGTATTCCAGATGACGAATGGGAAATCCTT
GCTTCAGACGAAATGAGTAATGAGGATTTAGCAAAAAAAAAACATTTCGAATGGATAAAA
AAAATAAAATTGGCTTATTAGGGAATTAAGGTCAAAGCTTAAGTCAAAAAGAAAAAGAAA
AAATCACTAGCTATGATTAAAAAAATGATTTCAAACGAGGCAATAAAAAGAAAACAAGAT
GGAGAAAAGTAATAAATTGATAGCAGCGACAGTGAAGATGAAGAAGTTGAAATGGATGAT
TTTACATCAGCAGTTAATTAATTTTTAAATCAAAGAGAAAAATGTGATCCATAGTTTAAT
CTAAAAGGAGAGGATAATATTTGGATAGTAAAACCTGCAGGATTATCAAGGGGAAGAGGA
ATAACTTGCTATAAAAATTTAGTTGAGATAATTGATCATGCAAAATCAATGGAACTCTAA
ATGATAGTCCAAAAATACATTGAAAATCCTGTTTTAATAAAATAAAGAAAATTCGATATT
AGAATATGGGTCCTTGTTACAGATTGGAATCCTTTAGCAATATGGTATTTTGATGAATGT
TACGTTCGCTTTAGTGCTGATAGCTACTCAACAAAAAATCTAAGCAATAAATTCTAGCAT
CTCACAAATAATGCTATCAGTAAAAAGAAGGCTTAATAAGGATAAGATGAAATAACTTTA
TAAGGGAATATGTATACTTAAGAGTAGCTTGAGAACTTTTTTATAGAAACTGAAGGATAT
AATGTATTCTAATAGAAAATAAAACCTCAAATTATAAATATAATAAAATGGTCAATTTTA
TCTTGTTCTGACACAGTTGAATCAAGGAAAAATAGTATGGAATTGTTTGGGTATGACATT
ATGATTGATACAAACTTTAATCCTTGGCTGTTAGAAGTTAATACATCTCCTTCTTTAGAA
TATTCCACAGAAATTACTAAAAAACTTGTTAAATAAGTTTTAGAAGATGTTGCTAAAGTA
GTTGTGGATTATGGTATGGCTCAAAAAAGTGGAATCAAAAAATCAGAATTATAGAAAATT
GGCACAGGAAAATTCATAAAAATTTATTAGGGATTAGAGATTTAAGATAAAGGAATCAAC
TCTATATAAAAAAACTTTATCTGTGAAGGATCTAAAATGAAGATAAGAAAACCAAAAAAG
CAAAAGAAAAATACTAAATTAGATAAAAAACAAAATTTACAACAAGATTTAACAATAAAT
AATTAAATAAACCATGATTAAAAATAATTTTCTTCTTAATAAGCCAACAATATAGAAACA
TATTCTAGACCATAAACTGCAAAATCATAAACTTAAAGTAGTAAAAAATTGTGA


>TTHERM_00196050(protein)
MKDVAATKQKFDTKNKLQQLELENENSQNNSYKTSNNLSKEEVIAVLQKQNRKKNVNFVQ
NDNQKLIDRHKEYLKQLKQQVTIEKETQKQLKKKDEENKIRLRNSVLASIKNDLTEQRKL
IQENHNLFLSKSTVSQSAKQISLPEINQSLTICLEKQKSEVEQEKKAVLTSQAFFRQSSL
REIEETNEKIESKTNLSKVKKLRPLPFISSMVEWKKKQRIPADSKIFIVMGGYKDFKKAL
LKRGWIENPQTNSPCFDLKWTLLGKDIDYDNILPNQIVNHFENNSKICSKIGLLNSLKNL
YWFDNADLNCFFPQCFDMNDPDEFNDFVKNFKLSKAVSVLKKYLRLYLEKDEKYNNCKIQ
AQVALQVLTRYYNDINNVIDDEKQASEYFKSIPDDEWEILASDEMSNEDLAKKKHFEWIK
KIKLAYQGIKVKAQVKKKKKKSLAMIKKMISNEAIKRKQDGEKQQIDSSDSEDEEVEMDD
FTSAVNQFLNQREKCDPQFNLKGEDNIWIVKPAGLSRGRGITCYKNLVEIIDHAKSMELQ
MIVQKYIENPVLIKQRKFDIRIWVLVTDWNPLAIWYFDECYVRFSADSYSTKNLSNKFQH
LTNNAISKKKAQQGQDEITLQGNMYTQEQLENFFIETEGYNVFQQKIKPQIINIIKWSIL
SCSDTVESRKNSMELFGYDIMIDTNFNPWLLEVNTSPSLEYSTEITKKLVKQVLEDVAKV
VVDYGMAQKSGIKKSELQKIGTGKFIKIYQGLEIQDKGINSIQKNFICEGSKMKIRKPKK
QKKNTKLDKKQNLQQDLTINNQINHDQKQFSSQQANNIETYSRPQTAKSQTQSSKKL


>TTHERM_00196050(gene)
ATGAAAGATGTAGCTGCCACCAAGTAAAAATTTGACACTAAAAATAAACTTCAACAATTA
GAATTAGAAAACGAAAATTCACAAAACAACTCGTACAAAACCTCTAACAACTTATCTAAA
GAAGAGGTCATTGCAGTTTTATAAAAACAAAATAGAAAGAGTCAAGTCAATTCAGTGCTC
GCTGATAACTCAAATATTCAAAATGATTTTTATCCTTAGTATAGAAAGCCAAAGAATCCT
ACCACAAAAAAACGATAAAGCACAGATTACACAAAAAGAAACACATTTTAATTAGAGAAT
TTGAATATTTAATAACAATTAAATAATAAAGATTCACTAAATTAACAAAATTAATAGTAA
CAAGATTTGGCTAAAAATAGAGTAGATAATTCATAAAACTAAGACATTTAAGCTAGACTT
TATGAAAGAACAGAATTGTAAAAGTTAAGAATCAAGTAAAAAGAAGAAGAATAAGCAGCC
CTGAAAAATAAGAGATAAACAAATAGAAGCTAATCTATTGAATGTATAGAAATTAATTTC
ATAAGAATTTATTAGTTTATTTTTTAATTTTAACGTTTAAAAAAGAAAATGTTAATTTCG
TGCAGAATGATAATTAAAAGCTCATAGATAGACATAAAGAATATTTAAAGCAGCTTAAAC
AGTAAGTAACAATAGAAAAAGAAACATAAAAGCAGCTTAAGAAGAAAGATGAAGAAAACA
AAATTAGATTAAGAAACTCTGTCTTAGCTTCAATCAAAAACGATTTAACCGAACAAAGAA
AATTAATATAGGAAAATCATAATTTATTTTTATCAAAGAGCACAGTATCATAAAGTGCAA
AGCAAAGTAATTGGTTGATTATTTATGTTTTAAAATAATTTTAAAGATTTAAAGATATTT
AATAGTTTTATAAATAAATTTATGAAAAAAAAAGAAAGATTTTATATTTACTATCAATTT
GATTAATTTATTTAAATTAAAATAATTAGTATCCCTTCCTGAAATAAACTAGTCTTTAAC
TATTTGTTTGGAAAAGCAAAAGAGTGAAGTTGAGCAGGAAAAGAAGGCCGTTTTGACTAG
TTAAGCTTTTTTCAGATAAAGCTCTTTGAGGGAAATAGAAGAAACAAATGAAAAAATAGA
ATCAAAGACTAATTTGTCTAAAGTAAAAAAACTTAGACCTTTGCCATTTATAAGCTCTAT
GGTTGAATGGAAAAAAAAGCAAAGAATTCCTGCTGATTCTAAAATATTTATAGTTATGGG
AGGATACAAAGATTTTAAGAAAGCTCTTTTAAAGAGAGGGTGGATAGAAAACCCATAAAC
TAATAGTCCTTGTTTTGATCTGAAATGGACTTTGTTAGGAAAAGATATTGACTATGATAA
TATTTTACCTAATTAAATAGTAAATCATTTTGAAAATAATTCGAAAATATGCTCAAAAAT
AGGATTGCTAAATAGTCTTAAAAATTTATATTGGTTTGACAATGCAGACCTAAATTGTTT
TTTTCCTTAATGTTTCGATATGAATGATCCTGATGAATTTAATGACTTCGTCAAAAATTT
TAAGCTCAGCAAAGTAATTTAAATTATATTCTAAAAGAAATTAAAATTATGCTTTTTCGA
TTAATAGGCTGTTTCAGTTTTGAAAAAGTATTTAAGATTATATCTTGAAAAAGATGAAAA
ATATAACAACTGTAAAATACAGGCTTAAGTAGCTCTTTAGGTTCTTACACGTTATTATAA
TGATATTAATAATGTAATAGATGACGAAGTAATTTTTTCTTTTGTTTTTATCTTTTACAT
AGTTTACATAAAAAGAAATAAGCATCCGAATATTTTAAAAGTATTCCAGATGACGAATGG
GAAATCCTTGCTTCAGACGAAATGAGTAATGAGGATTTAGCAAAAAAAAAACATTTCGAA
TGGATAAAAAAAATAAAATTGGCTTATTAGGGAATTAAGGTCAAAGCTTAAGTCAAAAAG
AAAAAGAAAAAATCACTAGCTATGATTAAAAAAATGATTTCAAACGAGGCAATAAAAAGT
AGCTATAATTTAAACTTGTGCAATATTTATAATAATTCTTTATTTTTAAGGAAAACAAGA
TGGAGAAAAGTAATAAATTGATAGCAGCGACAGTGAAGATGAAGAAGTTGAAATGGATGA
TTTTACATCAGCAGTTAATTAATTTTTAAATCAAAGAGAAAAATGTGATCCATAGTTTAA
TCTAAAAGGAGAGGATAATATTTGGATAGTAAAACCTGCAGGTTTTTTATTAATTTATTT
ATTTTGAAAAATATAACTTATTAAATAATTAGGATTATCAAGGGGAAGAGGAATAACTTG
CTATAAAAATTTAGTTGAGATAATTGATCATGCAAAATCAATGGAACTCTAAATGATAGT
CCAAAAATACATTGAAAATCCTGTTTTAATAAAATAAAGAAAAGTAAAATTAAATTTATT
TATAAATGCCTTTTAAATAATATTTTATTAGTTCGATATTAGAATATGGGTCCTTGTTAC
AGATTGGAATCCTTTAGCAATATGGTATTTTGATGAATGTTACGTTCGCTTTAGTGCTGA
TAGCTACTCAACAAAAAATCTAAGCAATAAATTCTAGCATCTCACAAATAATGCTATCAG
TAAAAAGAAGGCTTAATAAGGATAAGATGAAATAACTTTATAAGGGAATATGTATACTTA
AGAGTAGCTTGAGAACTTTTTTATAGTAAAAATATCATTTAATTTTTTCTGTATTTAATT
AAAGATTTTTTATAGGAAACTGAAGGATATAATGTATTCTAATAGAAAATAAAACCTCAA
ATTATAAATATAATAAAATGGTCAATTTTATCTTGTTCTGACACAGTTGAATCAAGGAAA
AATAGTATGGAATTGTTTGGGTATGACATTATGATTGATACAAACTTTAATCCTTGGCTG
TTAGAAGTTAATACATCTCCTTCTTTAGAATATTCCACAGTAAAATGAACTTAATTTTTA
TTTAAAATTAAAATAATCTAATTTAATTTAAATTTACAGGAAATTACTAAAAAACTTGTT
AAATAAGTTTTAGAAGATGTTGCTAAAGTAGTTGTGGATTATGGTATGGCTCAAAAAAGT
GGAATCAAAAAATCAGAATTATAGAAAATTGGCACAGGAAAATTCATAAAAATTTATTAG
GGATTAGAGATTTAAGATAAAGGAATCAACTCTATATAAAAAAACTTTATCTGTGAAGGA
TCTAAAATGAAGATAAGAAAACCAAAAAAGCAAAAGAAAAATACTAAATTAGATAAAAAA
CAAAATTTACAACAAGATTTAACAATAAATAATTAAATAAACCATGATTAAAAATAATTT
TCTTCTTAATAAGCCAACAATATAGAAACATATTCTAGACCATAAACTGCAAAATCATAA
ACTTAAAGTAGTAAAAAATTGTGA