Identifiers and Description

Gene Model Identifier

TTHERM_00193960

Standard Name

None

Aliases

PreTt06680 | 16.m00336

Description

translation initiation factor 2B subunit eIF-2B alpha/beta/delta family protein; Initiation factor 2 subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02179 ) BAG domain
  • ( PF08103 ) Uperin family
  • ( PF01008 ) Initiation factor 2 subunit family
  • ( PF04818 ) Protein of unknown function, DUF618
  • ( TIGR00511 ) ribose-1,5-bisphosphate isomerase, e2b2 family
  • ( TIGR00524 ) eIF-2B alpha/beta/delta-related uncharacterized proteins

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00193960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03672.19.997093137033517e-262initiation factor 2 subunit pr
otein (334 aa)
DictyBaseDDB_G02912711.9990871925214856e-61eif2b2 on chromosome: 6 positi
on 38541 to 39827
OxytrichaContig18132.0.g714.001501063932074e-49Initiation factor 2 subunit fa
mily
SGDYLR291C1.999683289470905e-41GCD7 Beta subunit of the trans
lation initiation factor eIF2B
, the guanine-nucleotide excha
nge factor for eIF2; activity
subsequently regulated by phos
phorylated eIF2; first identif
ied as a negative regulator of
GCN4 expression
Stentor CoeruleusSteCoe_290734.359610000063081e-28
WormBaseWBGene000142212.0002795641672355e-21Probable translation initiatio
n factor eIF-2B subunit alpha
status:Confirmed UniProt:P
34604 protein_id:CAA80132.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00193960(coding)
ATGAAAAGATTAATTGACCCCTTAAGAGAAGATAAAAGCTCTTATTAAATGGCTAAAGAA
ACAGCTCAAATTATTTTAGATATTGCCTAATCCTCTAAATACTAAAGCGTTTAAGAATTA
ACTAAGACAATCAACAAAGCTGGCAAAATGATTTTGGAAGAAAATCCACTTGAGTTTTCA
ATTGAAAATGTTATTAGAAAGATTATAAGCATTATCAAAGATATTAACGAATAAAATGAT
AAAAAGAAGAACAAGGGTTTTTCTAATCTTAAAAAATTATTCGAAAAAGAAGATGCAAAT
GAAGATCTAACTCCAGCAAATGTAGAAGATAAGGAAGAATTCAAAGCTAAGCGCACCAAA
TTTATAGATGCAATTTAAGGATTATTACAAGAGTTAGATGATTTGTCAGATACAATAAAC
GATTATGCTGCTAATCATATTAACTCAGGAGAAGTTATTTTAACTTACGGGTACTCTGAA
ACTATTAAGCTCTTTTTAATAGATGCTAAAAAACAAAGAAACTTTGAAGTTATTGTTTTA
GATGGAGAATGTAAGTAATCAGGTTAAAAAATGGCTTAAGACCTTGCCGATGAAGGAATT
ACTACTTCTCTTATTCCATTCTCTTCTGCTTATGCATTCATGTCCAGGGTCAATAAAGTT
TTCATAGGTGCTCATGCCATTATGAAAAACGGTGGTGTCCTAGGTAGAAACGGTATATTA
ATGCTCACCACAGCTGCTAAAGCTTACTCAGTTCCTGTTATTGTGCTTGCTTCAGCTATA
AAATTAACTCCTCATTTCCCCTTTGAATAAAATACTTTCAATGAAACTCTCAATCCTCAA
GAAATGCTTCCTAACACTGTTTCTTACAATAATAATGAAACAATTATTGTTACTAGATTC
GACTACGTTGCTCCTGAATACATAAATCTATACATAACAAACTATGGAGAGCATACTCCA
GCTTATATTTATCGCCTTTTTAATGAATATTATCAAAATTGA


>TTHERM_00193960(protein)
MKRLIDPLREDKSSYQMAKETAQIILDIAQSSKYQSVQELTKTINKAGKMILEENPLEFS
IENVIRKIISIIKDINEQNDKKKNKGFSNLKKLFEKEDANEDLTPANVEDKEEFKAKRTK
FIDAIQGLLQELDDLSDTINDYAANHINSGEVILTYGYSETIKLFLIDAKKQRNFEVIVL
DGECKQSGQKMAQDLADEGITTSLIPFSSAYAFMSRVNKVFIGAHAIMKNGGVLGRNGIL
MLTTAAKAYSVPVIVLASAIKLTPHFPFEQNTFNETLNPQEMLPNTVSYNNNETIIVTRF
DYVAPEYINLYITNYGEHTPAYIYRLFNEYYQN


>TTHERM_00193960(gene)
ATGAAAAGATTAATTGACCCCTTAAGAGAAGATAAAAGTAGAAAATAGTTTGATTTATGC
AATGTTAAACATGTCTTTTCAAAGATTAATTATGAAAAGCCTCATATGCCTTACATTTTT
ATATGACTATTTGACTTATTTAAATAGATTTAATAATGCAAATAAATAAATGATTCATAT
AATCAAAGCAAAGACTTTCTAATTTAAATATTTTTATAATAACAGGCTCTTATTAAATGG
CTAAAGAAACAGCTCAAATTATTTTAGATATTGCCTAATCCTCTAAATACTAAAGCGTTT
AAGAATTAACTAAGACAATCAACAAAGCTGGCAAAATGATTTTGGAAGAAAATCCACTTG
AGTTTTCAATTGAAAATGTTATTAGAAAGATTATAAGCATTATCAAAGATATTAACGAAT
AAAATGATAAAAAGAAGAACAAGGGTTTTTCTAATCTTAAAAAATTATTCGAAAAAGAAG
ATGCAAATGAAGATCTAACTCCAGCAAATGTAGAAGATAAGGAAGAATTCAAAGCTAAGC
GCACCAAATTTATAGATGCAATTTAAGGATTATTACAAGAGTTAGATGATTTGTCAGATA
CAATAAACGATTATGTAATTTGTTTGAGACTTAAGTTTATAATTTGTATCATATTTAAAT
ATATTTTGTCATTTTTACATTCATTTAAATGCTTTTAAAATAAAAAAACATTTTTTTTAT
TGATTTTGTTAGGCTGCTAATCATATTAACTCAGGAGAAGTTATTTTAACTTACGGGTAC
TCTGAAACTATTAAGCTCTTTTTAATAGATGCTAAAAAACAAAGGTTTTAATTGAATTTA
TAATAGATTTAAATATTTTAAATAATTTAATTGTTTAATAAATTTTAGAAACTTTGAAGT
TATTGTTTTAGATGGAGAATGTAAGTAATCAGGTTAAAAAATGGCTTAAGACCTTGCCGA
TGAAGGAATTACTACTTCTCTTATTCCATTCTCTTCTGCTTATGCATTCATGTCCAGGGT
CAATAAAGTTTTCATAGGTAACTTAAATTTTGTTTTATTAAGATTACTTATAATTGTATG
TTTTTTAGGTGCTCATGCCATTATGAAAAACGGTGGTGTCCTAGGTAGAAACGGTATATT
AATGCTCACCACAGCTGCTAAAGCTTACTCAGTTCCTGTTATTGTGCTTGCTTCAGCTAT
AAAATTAACTCCTCATTTCCCCTTTGAATAAAATACTTTCAATGAAACTCTCAATCCTCA
AGAAATGCTTCCTAACACTGTTTCTTACAATAATAATGAAACAATTATTGTTACTAGATT
CGACTACGTTGCTCCTGAATACATAAATCTATACATAACAAACTATGGAGAGCATACTCC
AGCTTATATTTATCGCCTTTTTAATGAATATTATCAAAATTGA