Identifiers and Description

Gene Model Identifier

TTHERM_00191760

Standard Name

None

Aliases

PreTt08826 | 15.m00537 | 3697.m00248

Description

polycystin cation channel protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01920 ) Prefoldin subunit
  • ( PF04423 ) Rad50 zinc hook motif
  • ( PF08016 ) Polycystin cation channel
  • ( PF07670 ) transporter gate domain protein
  • ( PF00520 ) transporter, cation channel family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00191760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06149.19.997093137033517e-262hypothetical protein (602 aa)
OxytrichaContig12043.0.g559.9981864321491e-40Domain of unknown function (DU
F4389)
Stentor CoeruleusSteCoe_96569.602680054508676e-24
DictyBaseDDB_G02912751.0004572433669413e-23mcln on chromosome: 6 position
41617 to 44215
WormBaseWBGene000008467.000255027549774e-17locus:cup-5 status:Partially
_confirmed UniProt:H2KYK0
protein_id:CCD63612.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00191760(coding)
ATGAACAATATTAAAAGTAGATAATACAAAATGAGCTTCAATGAGAAGATCACTTTGAGC
CCATTTTAAAAGTACTATAAATTTAACAGGTTTCCATGGAAGTTTTTAATTCATATTCTT
TTAGTGATATTCACTACCTATTAGGCTTTGTCTATGGTTTCTCTTAGAACATCTCATTCT
CGTGCCTAGCATTAAGTCTTTAAATATATTTTATTTGGTTCAGATGATGAGTCAAATTCT
GTGCCTTTTTACAAATTAGAGCAGTTTACTGAAAACGTGAGAAATGTATGCACAACTTTA
TCTAATTTGAATGATAAACTTCTTTAGTATGCTGACATTACAAGCAGCAAGAATTCTCTA
TAGATTTACTATTCTGAATTCAATTTAGAAAATGCTTAGCAAGCAGATGTAGAAATTCCT
GATATTGAAAAATGCATTAAATAGCCTTTTGATATCGATGACGAAGTTTCTGTTAAAAAT
TTTTTAAACTAAATCACTAAGATGAACTTTATTTCTGAAGGCATAAAAACTTTTACCAGA
TATAGCGACTCTCCAGATTAGTAGTCCTGCTTAGAGTGGACAATTACTATTGAATACGAT
TTCGAATCCTATGCTAATATAGAAGCAACAATAGATACACAAAGCATCTTGTGTGAAGGC
CAAAATACTGAGTCAACATTTGGATATAACTATGTCTTTATTCATAGTATTGTTGCTATC
CTTGCTATAATTTCGTTAGCTCTCTCTACCAAGTATATTTATGAAGTTGGTAAAAAGTAC
ATCAAGCATAAAATCATTTACGAAAATGTCTAAAAGTAATTCAATTTTCACAGAGAAGAA
GAAAGTAAATTAAAAGTTCGCGACTCTTTTGACATACAAAAACTAGAATAAGAGGAAAAA
AAAGACAGCGACGATTTGGATATTGAAGAATTGCTAAAGGATAATAAGTAATGGGATGAT
ATTGGTTTCTTTAATAAACTTAAATTTTTCAACCTCTGGATAGTAGTATCAATAGTAGGG
AATATAGTTCAAATAATTGGATGTTTTATAGCCATTTTAGATACATACATGGAATAGAAT
CTAAATGTATTCATTTATAAAGAATCTATCATTGGTTTTGGATCTATGTTTGCATGGATT
ATTATGCTGAACTATCTCTAATATAACAAGAATGTTAACTTAATGACCTCCACTTTACAG
AAAGCTTCTTCTAATATATTTATGTTCTTGTTGGGTGTTCTTCCTTTCTTCTTTGGCTTT
GTTTTTTTGGGCTAGTGCATATTCTGGAAATATACAAAGTTTGAAGACACAACAACCACA
ATCATCACTCTCTTTTCTTTGAGTAACGGAGATATTGTGAATGAAACATTTATGGATACT
TGGGCTGAAGGTATTTTAGGATAAATTTACTTAATAGTGTTCATGATTCTTTTCTTTACT
GCAGTACAAAACGTATTCATCACTATTATTATGGAAGGCTATGATGATTCTAAAAGAGAC
AAATCAAATGAAGTTAAAGAAAGCGAAGAAGAAGCATAAAAATTGGATTAAGATGTTGAG
CCGGAAGAAGACAATATCATATAAAATGTTGGTTAATCTAAAAGTGATAAGGATATGGTT
TTAAATAAGCTACGTATAAACACAAAAAGAATCAAAAAAATTCTTGACGAAATGGAATCT
GCTTACAAAAAAATAGGTGAAGCAAAATTAAAAAGAGAGGATAAAGATTATCTTATCAGA
GTTTACCATGATAATTTAGATAACTTGAATAGAAATCTTAAATTTTAATTAACAACTATG
GGCAGATGA


>TTHERM_00191760(protein)
MNNIKSRQYKMSFNEKITLSPFQKYYKFNRFPWKFLIHILLVIFTTYQALSMVSLRTSHS
RAQHQVFKYILFGSDDESNSVPFYKLEQFTENVRNVCTTLSNLNDKLLQYADITSSKNSL
QIYYSEFNLENAQQADVEIPDIEKCIKQPFDIDDEVSVKNFLNQITKMNFISEGIKTFTR
YSDSPDQQSCLEWTITIEYDFESYANIEATIDTQSILCEGQNTESTFGYNYVFIHSIVAI
LAIISLALSTKYIYEVGKKYIKHKIIYENVQKQFNFHREEESKLKVRDSFDIQKLEQEEK
KDSDDLDIEELLKDNKQWDDIGFFNKLKFFNLWIVVSIVGNIVQIIGCFIAILDTYMEQN
LNVFIYKESIIGFGSMFAWIIMLNYLQYNKNVNLMTSTLQKASSNIFMFLLGVLPFFFGF
VFLGQCIFWKYTKFEDTTTTIITLFSLSNGDIVNETFMDTWAEGILGQIYLIVFMILFFT
AVQNVFITIIMEGYDDSKRDKSNEVKESEEEAQKLDQDVEPEEDNIIQNVGQSKSDKDMV
LNKLRINTKRIKKILDEMESAYKKIGEAKLKREDKDYLIRVYHDNLDNLNRNLKFQLTTM
GR


>TTHERM_00191760(gene)
ATGAACAATATTAAAAGTAGATAATACAAAATGAGCTTCAATGAGAAGATCACTTTGAGC
CCATTTTAAAAGTACTATAAATTTAACAGGTTTCCATGGAAGTTTTTAATTCATATTCTT
TTAGTGATATTCACTACCTATTAGGCTTTGTCTATGGTTTCTCTTAGAACATCTCATTCT
CGTGCCTAGCATTAAGTCTTTAAATATATTTTATTTGGTTCAGATGATGAGTCAAATTCT
GTGCCTTTTTACAAATTAGAGCAGTTTACTGAAAACGTGAGAAATGTATGCACAACTTTA
TCTAATTTGAATGATAAACTTCTTTAGTATGCTGACATTACAAGCAGCAAGAATTCTCTA
TAGATTTACTATTCTGAATTCAATTTAGAAAATGCTTAGCAAGCAGATGTAGAAATTCCT
GATATTGAAAAATGCATTAAATAGCCTTTTGATATCGATGACGAAGTTTCTGTTAAAAAT
TTTTTAAACTAAATCACTAAGATGAACTTTATTTCTGAAGGCATAAAAACTTTTACCAGA
TATAGCGACTCTCCAGATTAGTAGTCCTGCTTAGAGTGGACAATTACTATTGAATACGAT
TTCGAATCCTATGCTAATATAGAAGCAACAATAGATACACAAAGCATCTTGTGTGAAGGC
CAAAATACTGAGTCAACATTTGGATATAACTATGTCTTTATTCATAGTATTGTTGCTATC
CTTGCTATAATTTCGTTAGCTCTCTCTACCAAGTATATTTATGAAGTTGGTAAAAAGTAC
ATCAAGCATAAAATCATTTACGAAAATGTCTAAAAGTAATTCAATTTTCACAGAGAAGAA
GAAAGTAAATTAAAAGTTCGCGACTCTTTTGACATACAAAAACTAGAATAAGGTATTTAT
TTTAAACACTACTGAATATCTATATTTATTAAAAAAAACTACTTTTTGTAAATAGAGGAA
AAAAAAGACAGCGACGATTTGGATATTGAAGAATTGCTAAAGGATAATAAGTAATGGGAT
GATATTGGTTTCTTTAATAAACTTAAATTTTTCAACCTCTGGATAGTAGTATCAATAGTA
GGGAATATAGTTCAAATAATTGGATGTTTTATAGCCATTTTAGATACATACATGGAATAG
AATCTAAATGTATTCATTTATAAAGAATCTATCATTGGTTTTGGATCTATGTTTGCATGG
ATTATTATGCTGAACTATCTCTAATATAACAAGAATGTTAACTTAATGACCTCCACTTTA
CAGAAAGCTTCTTCTAATATATTTATGTTCTTGTTGGGTGTTCTTCCTTTCTTCTTTGGC
TTTGTTTTTTTGGGCTAGTGCATATTCTGGAAATATACAAAGTTTGAAGACACAACAACC
ACAATCATCACTCTCTTTTCTTTGAGTAACGGAGATATTGTGAATGAAACATTTATGGAT
ACTTGGGCTGAAGGTATTTTAGGATAAATTTACTTAATAGTGTTCATGATTCTTTTCTTT
ACTGCAGTACAAAACGTATTCATCACTATTATTATGGAAGGCTATGATGATTCTAAAAGA
GACAAATCAAATGAAGTTAAAGAAAGCGAAGGTAAAAAAAATTATTTCAAATTTAATAAA
AAGTAAAGTAAATTTATTTTAATAAAAATTTAGAAGAAGCATAAAAATTGGATTAAGATG
TTGAGCCGGAAGAAGACAATATCATATAAAATGTTGGTTAATCTAAAAGTGATAAGGATA
TGGTTTTAAATAAGCTACGTATAAACACAAAAAGAATCAAAAAAATTCTTGACGAAATGG
AATCTGCTTACAAAAAAATAGGTGAAGCAAAATTAAAAAGAGAGGATAAAGATTATCTTA
TCAGAGTTTACCATGATAATTTAGATAACTTGAATAGAAATCTTAAATTTTAATTAACAA
CTATGGGCAGATGA