Identifiers and Description

Gene Model Identifier

TTHERM_00189617

Standard Name

None

Aliases

3697.m01702

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.2%

TetraMine Data

TTHERM_00189617

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06237.19.999353957415832e-59hypothetical protein (108 aa)
DictyBaseDDB_G02884791.9999391735788327e-19lsm8 on chromosome: 5 position
1585841 to 1586699
WormBaseWBGene000030823.9992896861436003e-19locus:lsm-8 status:Confirmed
UniProt:Q95XD4 protein_id
:CCD74179.1
SGDYJL124C2.0004286606204839e-16LSM1 Lsm (Like Sm) protein; fo
rms heteroheptameric complex (
with Lsm2p, Lsm3p, Lsm4p, Lsm5
p, Lsm6p, and Lsm7p) involved
in degradation of cytoplasmic
mRNAs
OxytrichaContig15780.0.g754.0002685161515803e-16LSM domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00189617(protein)
MEDKKDKYQPIKLLNPLEKLLFKKIQIITTDGKVLIGILKGLDQALNSILSDCVERVFSS
ENNTKTIKHGLYLLRGDNIAVLGEVDEEIENQINYDSKIQCLKPITN


>TTHERM_00189617(coding)
ATGGAAGATAAAAAAGATAAGTATTAGCCAATCAAGCTCTTAAATCCTCTCGAAAAGCTA
CTTTTTAAAAAAATATAGATAATAACTACTGATGGCAAGGTTTTGATAGGTATCTTGAAA
GGTTTAGATTAAGCTTTAAATTCAATATTATCAGATTGTGTAGAGAGAGTTTTTTCATCA
GAAAATAATACCAAAACTATTAAGCATGGTCTTTATTTACTTAGAGGTGATAACATTGCT
GTATTAGGTGAGGTAGATGAAGAAATAGAAAACTAAATAAACTACGATTCTAAAATATAG
TGCTTAAAACCAATAACTAACTGA


>TTHERM_00189617(gene)
ATGGAAGATAAAAAAGATAAGTATTAGCCAATCAAGCTCTTAAATCCTCTCGAAAAGCTA
CTTTTTAAAAAAATATAGATAATAACTACTGATGGCAAGGTTTTGATAGGTAATCGTTTA
CTTTCTTTAGGATAAAGGATCATAATTATTATTTTATGAATGCTTGTATTAGGTATCTTG
AAAGGTTTAGATTAAGCTTTAAATTCAATATTATCAGATTGTGTAGAGAGAGTTTTTTCA
TCAGAAAATAATACCAAAACTATTAAGCATGGTCTTTATTTACTTAGAGGTGATAACATT
GCTGTATTAGGTAAGTTTCATTCTAGTTTTTTTAATATATAATCAAGTAATAATTGTAGA
CGCATTTACAAAAAAGGATTTTAAGATACTTTAACATTAAAAATCTAACTTTACTTATTA
AAAAAAAGGTGAGGTAGATGAAGAAATAGAAAACTAAATAAACTACGATTCTAAAATATA
GTGCTTAAAACCAATAACTAACTGA