Identifiers and Description

Gene Model Identifier

TTHERM_00189270

Standard Name

PAH1  (Phosphatidic Acid phosphoHydrolase )

Aliases

PreTt08677 | 15.m00388 | 3697.m00100

Description

LNS2 (lipin/Ned1/SMP2) protein; Mg2+-dependent phosphatidate (PA) phosphatase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08235 ) LNS2 (Lipin/Ned1/Smp2)
  • ( PF04571 ) lipin, N-terminal conserved region
  • ( PF03767 ) HAD superfamily (subfamily IIIB) phosphatase
  • ( TIGR03333 ) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00189270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06282.19.997093137033517e-262lipin (872 aa)
OxytrichaContig18266.0.g541.0001267035975107e-72LNS2 (Lipin/Ned1/Smp2)
DictyBaseDDB_G02717304.99966753182923e-69DDB_G0271730 on chromosome: 2
position 868232 to 872209
WormBaseWBGene000104258.996727126836489e-63locus:lpin-1 status:Confirme
d UniProt:Q9XXT5 protein_i
d:CAA16154.2
SGDYMR165C3.000235161122315e-61PAH1 Mg2+-dependent
phosphatidate (PA) phosphatas
e, catalyzes the dephosphoryla
tion of PA to yield diacylglyc
erol, responsible for de novo
lipid synthesis and formation
of lipid droplets; homologous
to mammalian lipin 1
Stentor CoeruleusSteCoe_85791.6458114310822737e-38

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00189270(coding)
ATGAGTGTTTTAAAAAAACTATAAGAAGTTTTTGATATAAATGAATCTACTTTGAGTGGT
TGTGTTGATATTATTTGCATAGAGTAGCCTGATAAAACTCTTAAGTCCTCTTCTTTCCAT
GTTAGATTTGGAAAGTTCAAAGTACTTAAAAGCAATGAAAAGATAGTTACTATCAAGATT
AATGATATAATTCAAAAAGTTACTATGAAGATGGATTCAACAGGAGAAGCTTATTTTGAA
GATATTAGAGATGAAAGCGCTTTGGAAAAAATATTTAATGCAGGTCTTTCATCAGATGAT
GCGTTTTCAGATTATGAAATACCAAATATGTAATCAGATGATGAAGGTGCATTTGACAAA
GAAAAGATAAATGAACAGATAAGCAAAAATTAGTATAGGTTTGATGATTTAGTTTCTCCA
TACAAAGACGTAAAAGAAAAAGAAAAAGAAGGAAAGTAAGCAAATAACATAAATGTCAGT
AATTAAGGATAGCAAACTAAGGAAAAGGAGGTATCAGCTCTACCTTAAAATTAAAATTAA
CCTGAATAGAAGAAAGGAGGATTTTGGCATTCTATTTTTGGTGGTAGAAAGAAATAAGAA
GATAGTATAAGTAATCAGACTAGTAGAAAAAATTCAGAAAATCCTACTTTAGAAGAGCTA
CAAAAAATTACTTAAGAGTAGGTTAAAGAATAGAATATAAGTGAAGTAAAATAAGAAGGA
TCTACTTAACTGCCAAGTTCTTCATTTAATTCTAATGGTGTAGCTTCAAGTGATATCGAA
AGCGAAGTTGATAAATTTGTTATCAATGACGAAATTTAGGAGCGCAGTAAAAATTAATAA
AAGAATCAAAATATAAATAATAGCAAATCTTAAGTCAGTAATTCTAATAGCTTGTAATTC
AAAGAAGATAAATATAAAATGAGTGAAGTAGTAGAAAATTTAGAAAAAAAGAAGCCTTCT
CCTTCTATGGAAAAGAAATCATCTACTGAAGGAGTAAGTGAAACCTTAGAGAGAAAAGAA
AGTTAAAAATAATTAAACACTAATTAGAGCCAGACAAATACCTAAAATTCAGAAAAGGAT
AAAAAGAAAGATGGAAAAGATTAAAATAAGATTGAGATGAAAGATCTCATTGATTAAAAT
AAAGATCTTAAAGATTTAATATCTTCAAAAAAGCAAGATAAATAGTAAGTAGCTTAATAG
GAGGCTGGTAAAATCTAAGAAGTTAAAGAAGAAGGAAATGAAGAGGAAGAAGATGAAGAA
GAAGAGGATGAAGATGAAATGGAAATAGGTTTATCACTTTGCAATAACGTTTAGCAGAAA
AAAGGTGAAAATAAATCATTAGATTAGTTATTTGAAGATTATAAAGTTACTTATGAACAA
TTCAGTTAAGATCCAGTCAAGATTTTAAATGATAAAAATCTTTTGCTTAAAATTGGATAT
CATTTATATCCCTTAGAAATTGCTTCCACAATTCTTATTTGTCGTTTGGCATTCAAATAA
GAAATCCCTGATAATGTTCTACAAAATATGATTAAGCAATAAAAAAAGAAATCATCTTCT
GGTTTCTTAGATTTCTTTTTCCGCCGTAACAAAAATGAAAGCACTCCACAATCTGATGTA
CTTGGCTAAATTATGCCTATGCTTGATAAAGATTGGACTCATGAAGGCGTCATTAGTTTA
TATTAAAATATAGTCAAAAATGGCTATTAAATTTTATATTTAACTGCAAGAGCTATTGGG
CAATCGGAGTAAACCAGAAAATTTATCTATAATGTGAAGCAAGAAAACGTCAATCTCCCT
TTAGGACCTGTAATAATGTCATCTGATAGATTACTTAAATCTTTTAAAAGAGAAGTTATA
GACAGAAAACCTGAGGTTTTTAAAATTGCTGTTTTAAGAGAAATTTAGTCTTTGTTCCCT
AATAAAAACGTCTATTATGCAGGATTTGGAAATAGAGAAACAGATGCTGTAGCCTACAGA
GCAGTTTAAGTTAGTATTTAAAAAATTTACATTATTAATCCAGCTTCAGAGCTTCACTAA
ATAAATAACACTTTCAAAAAAAGCTATTTATAGTTAAATGATATGGTTGATTAAGTATTT
CCTCCCATCAAGCAGGAAGAAGATTAAATTTAAGAAGAATATAATTCATTTAATTTCTGG
AAAATAAAACCACCAGCTGTTGAAGATATTAACTAACTATTAAGCGAATGA


>TTHERM_00189270(protein)
MSVLKKLQEVFDINESTLSGCVDIICIEQPDKTLKSSSFHVRFGKFKVLKSNEKIVTIKI
NDIIQKVTMKMDSTGEAYFEDIRDESALEKIFNAGLSSDDAFSDYEIPNMQSDDEGAFDK
EKINEQISKNQYRFDDLVSPYKDVKEKEKEGKQANNINVSNQGQQTKEKEVSALPQNQNQ
PEQKKGGFWHSIFGGRKKQEDSISNQTSRKNSENPTLEELQKITQEQVKEQNISEVKQEG
STQLPSSSFNSNGVASSDIESEVDKFVINDEIQERSKNQQKNQNINNSKSQVSNSNSLQF
KEDKYKMSEVVENLEKKKPSPSMEKKSSTEGVSETLERKESQKQLNTNQSQTNTQNSEKD
KKKDGKDQNKIEMKDLIDQNKDLKDLISSKKQDKQQVAQQEAGKIQEVKEEGNEEEEDEE
EEDEDEMEIGLSLCNNVQQKKGENKSLDQLFEDYKVTYEQFSQDPVKILNDKNLLLKIGY
HLYPLEIASTILICRLAFKQEIPDNVLQNMIKQQKKKSSSGFLDFFFRRNKNESTPQSDV
LGQIMPMLDKDWTHEGVISLYQNIVKNGYQILYLTARAIGQSEQTRKFIYNVKQENVNLP
LGPVIMSSDRLLKSFKREVIDRKPEVFKIAVLREIQSLFPNKNVYYAGFGNRETDAVAYR
AVQVSIQKIYIINPASELHQINNTFKKSYLQLNDMVDQVFPPIKQEEDQIQEEYNSFNFW
KIKPPAVEDINQLLSE


>TTHERM_00189270(gene)
ATGAGTGTTTTAAAAAAACTATAAGAAGTTTTTGATATAAATGAAGTAATTTATTTTTAT
TCTCCACTTGCAAGTTCTGCCTTCTTTTTATATACTCAAATTTTATTTTTATTACCTAAA
GTCTACTTTGAGTGGTTGTGTTGATATTATTTGCATAGAGTAGCCTGATAAAACTCTTAA
GTCCTCTTCTTTCCATGTTAGATTTGGAAAGTTCAAAGTACTTAAAAGCAATGAAAAGAT
AGTTACTATCAAGATTAATGATATAATTCAAAAAGTTACTATGAAGATGGATTCAACAGG
AGAAGCTTATTTTGAAGATATTGTAATCAATTTTCATATCTATTTTTTAAATTAAAATTA
GCAAAACTCATTTAATATTACTTTATTCTAAAAAAGAGAGATGAAAGCGCTTTGGAAAAA
ATATTTAATGCAGGTCTTTCATCAGATGATGCGTTTTCAGATTATGAAAGTATTTCCAAA
ATGTATATCATTTAAAGTAACAAATATACATAATTATATAGTACCAAATATGTAATCAGA
TGATGAAGGTGCATTTGACAAAGAAAAGATAAATGAACAGATAAGCAGTAAATAAAATTC
AATTTATAATGAGTTTATAGCATTATAAACGTTAATAAAAGAAAATTAGTATAGGTTTGA
TGATTTAGTTTCTCCATACAAAGACGTAAAAGAAAAAGAAAAAGAAGGAAAGTAAGCAAA
TAACATAAATGTCAGTAATTAAGGATAGCAAACTAAGGAAAAGGAGGTATCAGCTCTACC
TTAAAATTAAAATTAACCTGAATAGAAGAAAGGAGGATTTTGGCATTCTATTTTTGGTGG
TAGAAAGAAATAAGAAGATAGTATAAGTAATCAGACTAGTAGAAAAAATTCAGAAAATCC
TACTTTAGAAGAGCTACAAAAAATTACTTAAGAGTAGGTTAAAGAATAGAATATAAGTGA
AGTAAAATAAGAAGGATCTACTTAACTGCCAAGTTCTTCATTTAATTCTAATGGTGTAGC
TTCAAGTGATATCGAAAGCGAAGTTGATAAATTTGTTATCAATGACGAAATTTAGGAGCG
CAGTAAAAATTAATAAAAGAATCAAAATATAAATAATAGCAAATCTTAAGTCAGTAATTC
TAATAGCTTGTAATTCAAAGAAGATAAATATAAAATGAGTGAAGTAGTAGAAAATTTAGA
AAAAAAGAAGCCTTCTCCTTCTATGGAAAAGAAATCATCTACTGAAGGAGTAAGTGAAAC
CTTAGAGAGAAAAGAAAGTTAAAAATAATTAAACACTAATTAGAGCCAGACAAATACCTA
AAATTCAGAAAGTAAATTATAATATAATAACTACCCACCATTAAAACTATTCAAAAGCAA
TAATTGAAACTGTTTGAAATTTTTTTCATATTTAAAAAAAGAGGATAAAAAGAAAGATGG
AAAAGATTAAAATAAGATTGAGATGAAAGATCTCATTGATTAAAATAAAGATCTTAAAGA
TTTAATATCTTCAAAAAAGCAAGATAAATAGTAAGTAGCTTAATAGGAGGCTGGTAAAAT
CTAAGAAGTTAAAGAAGAAGGAAATGAAGAGGAAGAAGATGAAGAAGAAGAGGATGAAGA
TGAAATGGAAATAGGTTTATCACTTTGCAATAACGTTTAGCAGAAAAAAGGTGAAAATAA
ATCATTAGATTAGTTATTTGAAGATTATAAAGTTACTTATGAACAATTCAGTTAAGATCC
AGTCAAGGTTAAAATTTATTTAAAGTCTTTAAATTAACTTAGGTAATTTGTATCTAAAAA
TAGATTTTAAATGATAAAAATCTTTTGCTTAAAATTGGATATCATTTATATCCCTTAGAA
ATTGCTTCCACAATTCTTATTTGTCGTTTGGCATTCAAATAAGAAATCCCTGATAATGTT
CTACAAAATATGATTAAGCAATAAAAAAAGAAATCATCTTCTGGTTTCTTAGATTTCTTT
TTCCGCCGTAACAAAAATGAAAGCACTCCACAGTAGAAGCCAGTAGAAGTAGAGCATACT
TAGCAGAAAGATAAAACCCTCAAAAAAGATATTTCTAATTTACAGTTAAATTCAGGAGAC
AAAAATGATTAGTAAGTATCTAGCCCAATACAATCCCCAAAAGTGCTGATAATCTTGATA
TAAATAAAGCTAGAAAAAATAGTGATGAACTCTCAGTTGTGAGTGATTCTAACTCAGTAT
TTGGAAAATAAAAAATTAGAAAAACATTTAGACCAAAATCAGATATTCTCAAATCTTTTA
ATTTAAAACCTGGTGCTAACAAAATTAGTTTCACAGTAGTAACTAAATTGCTAGGAGAAT
AGACATTGGAAGGATATATTTATTTATGGTAGAGCAATGTCTAAATTGTAATTTCAGACA
TAGATGGAACAATCACCAAGTAAATTTTATATTATTTCAATAATATTAATAATAATAAAA
AATTATTATAATAAAGATCTGATGTACTTGGCTAAATTATGCCTATGCTTGATAAAGATT
GGACTCATGAAGGCGTCATTAGTTTATATTAAAATATAGTCAAAAATGGCTATTAAATTT
TATATTTAACTGCAAGAGCTATTGGGCAAGTAATTAATTAAATTAATTGATCTAATCTAT
ATTTTAAAATATTATAATTAAAGTCGGAGTAAACCAGAAAATTTATCTATAATGTGAAGC
AAGAAAACGTCAATCTCCCTTTAGGACCTGTAATAATGTCATCTGATAGATTACTTAAAT
CTTTTAAAAGAGAAGTTATAGACAGAAAACCTGAGGTTTTTAAAATTGCTGTTTTAAGAG
AAATTTAGTCTTTGTTCCCTAATAAAAACGTCTATTATGCAGGATTTGGAAATAGAGAAA
CAGTAGAATCAATTAATTTAATTTATAAAGTTAAATATTTTTTATATTAAAATAAAGGAT
GCTGTAGCCTACAGAGCAGTTTAAGTTAGTATTTAAAAAATTTACATTATTAATCCAGCT
TCAGAGCTTCACTAAATAAATAACACTTTCAAAAAAAGGTAAGGATTTAAAAAGTTTAAT
ATAAATTTATTTTATTATTTTATTTATTTAAATAAATAAATAAATTTTTTATAATTGAAA
AGCTATTTATAGTTAAATGATATGGTTGATTAAGTATTTCCTCCCATCAAGCAGGAAGAA
GATTAAATTTAAGAAGAATATAATTCATTTAATTTCTGGAAAATAAAACCACCAGCTGTT
GAAGATATTAACTAACTATTAAGCGAATGA