Identifiers and Description
Gene Model Identifier
TTHERM_00189180Standard Name
HHT2 (Histone H Three)Aliases
PreTt08668 | 15.m00379 | 3697.m00091Description
Histone H3; one of the four histones (H2A, H2B, H3 and H4) that comprise the protein core of the eukaryotic nucleosome; lysine-9 methylated in heterochromatin; encoded protein identical to Hht1p; upregulated in HHT3 knockoutsGenome Browser
![]()
Gene Ontology Annotations
No Data fetched for Gene Ontology Annotations
Domains
Gene Expression Profile
- Tetrahymena Functional Genomics Database: TTHERM_00189180
Homologs (v.2006 protein sequences)
Source Identifier Score Description IPI(HUMAN) IPI:IPI00719351.2 4.99786053911152e-53 Tax_Id=9606 PREDICTED: similar
to H3 histone, family 2 isofo
rm 2
DictyBase DDB0202045 1.00049949542646e-47 nek2 NEK family protein kinase
protein serine/threonine kina
se
ToxoDB 55.m00013 1.00049949542646e-47 Toxoplasma gondii histone H3
TAIR AT4G40040 9.99914281400154e-47 similar to histone H3.2 [Arabi
dopsis thaliana] (TAIR:At4g400
30.1)
TAIR AT4G40030 9.99914281400154e-47 histone H3.2
TAIR AT5G10980 9.99914281400154e-47 histone H3
FlyBase FBgn0053863 3.00090610398385e-46 FlyBase FBgn0053842 3.00090610398385e-46 FlyBase FBgn0053809 3.00090610398385e-46 FlyBase FBgn0053845 3.00090610398385e-46 FlyBase FBgn0053833 3.00090610398385e-46 FlyBase FBgn0053824 3.00090610398385e-46 FlyBase FBgn0053851 3.00090610398385e-46 FlyBase FBgn0053854 3.00090610398385e-46 FlyBase FBgn0053830 3.00090610398385e-46 FlyBase FBgn0053836 3.00090610398385e-46 FlyBase FBgn0053857 3.00090610398385e-46 FlyBase FBgn0053860 3.00090610398385e-46 FlyBase FBgn0053866 3.00090610398385e-46 FlyBase FBgn0051613 3.00090610398385e-46 FlyBase FBgn0053803 3.00090610398385e-46 FlyBase FBgn0053827 3.00090610398385e-46 FlyBase FBgn0053821 3.00090610398385e-46 FlyBase FBgn0053806 3.00090610398385e-46 FlyBase FBgn0053815 3.00090610398385e-46 FlyBase FBgn0053848 3.00090610398385e-46 FlyBase FBgn0053812 3.00090610398385e-46 FlyBase FBgn0053818 3.00090610398385e-46 FlyBase FBgn0053839 3.00090610398385e-46 CryptoDB EAK87921 3.99847995531501e-46 Cryptosporidium parvum (Iowa)
protein EAK87921
PlasmoDB PFF0865w 5.00238239385984e-46 Plasmodium falciparum PFF0865w
WormBase Y49E10.6 1.0003292389193e-45 WBGene00001946 his-72 Core his
tone H2A/H2B/H3/H4
ParameciumDB GSPATP00018066001 2.99915080840225e-45 Paramecium tetraurelia GSPATP0
0018066001 protein
SGD YBR010W 1.99968328947091e-41 HHT1 SGDID:S000000214, Chr II
from 256329-256739, Verified O
RF, "One of two identical hist
one H3 proteins (see also HHT2
); core histone required for c
hromatin assembly, involved in
heterochromatin-mediated telo
meric and HM silencing; regula
ted by acetylation, methylatio
n, and mitotic phosphorylation
"
SGD YNL031C 1.99968328947091e-41 HHT2 SGDID:S000004976, Chr XIV
from 576051-575641, reverse c
omplement, Verified ORF, "One
of two identical histone H3 pr
oteins (see also HHT1); core h
istone required for chromatin
assembly, involved in heteroch
romatin-mediated telomeric and
HM silencing; regulated by ac
etylation, methylation, and mi
totic phosphorylation"
General Information
Paragraph No Gene Name Paragraph Text 2 TWI1,
HHT2,
PDD1,
PDD3,
DCL1A proposed model for the mechanism of programmed DNA elimination in Tetrahymena is based on the timing of expression, cellular distribution, mutant phenotypes, and predicted functions of the protein and RNA components involved. In this model, both strands of the micronuclear genome (or perhaps only the portions containing internal eliminated sequences) are transcribed early in conjugation to produce large non-genic, double-stranded RNAs. This transcription is likely performed by RNA Polymerase II, based on the localization of its subunit Rpb3p to the micronucleus during this time. These transcripts pass to the cytoplasm where they are processed into short (~28 nucleotide) scan RNAs (scnRNA) by the dicer-like protein Dcl1p, similar to the production of the small inhibitory RNAs (siRNA) central to the RNA interference (RNAi) pathway of other eukaryotes. The scnRNAs complex with Twi1p, a member of the PPD (PAZ and Piwi Domain) protein family, whose members are commonly involved in RNAi and related processes. The scnRNA/Twi1p complexes enter the old macronucleus, where scnRNAs homologous to DNA sequences found there are degraded. The remaining scnRNAs, comprised of micronuclear-restricted sequences, are transferred to the developing macronucleus. There, histone H3 proteins (Hht1p, Hht2p) that are bound to sections of the genome sharing identity to the scnRNAs are methylated on lysine-9. This modification, which is often associated with the formation of heterochromatin, is recognized by one or more of the chromodomains belonging to Pdd1p and Pdd3p. Regions of DNA associated with these modified histones are eliminated from the developing macronuclear genome.
Associated Literature
No Data fetched for Associated Literature
Sequences
>TTHERM_00189180(coding)
ATGGCTAGAACTAAATAAACTGCTAGAAAGTCCACTGGTGCTAAGGCCCCCAGAAAATAA
CTCGCTTCCAAGGCCGCCAGAAAGTCTGCCCCCGCCACTGGTGGTATCAAGAAGCCCCAC
AGATTCAGACCTGGTACCGTCGCTCTCAGAGAAATCAGAAAGTACCAAAAGTCCACTGAT
TTGTTGATCAGAAAGCTCCCCTTCTAAAGATTGGTCAGAGATATTGCTCACGAATTCAAG
GCTGAACTCAGATTCTAATCTTCTGCCGTTCTTGCTCTCCAAGAAGCTGCTGAAGCTTAC
CTCGTCGGTCTCTTCGAAGATACCAACTTGTGCGCTATCCACGCTAGAAGAGTTACTATT
ATGACCAAGGATATGCAACTCGCTAGAAGAATTAGAGGTGAAAGATTCTGA>TTHERM_00189180(protein)
MARTKQTARKSTGAKAPRKQLASKAARKSAPATGGIKKPHRFRPGTVALREIRKYQKSTD
LLIRKLPFQRLVRDIAHEFKAELRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHARRVTI
MTKDMQLARRIRGERF>TTHERM_00189180(gene)
ATGGCTAGAACTAAATAAACTGCTAGAAAGTCCACTGGTGCTAAGGCCCCCAGAAAATAA
CTCGCTTCCAAGGCCGCCAGAAAGTCTGCCCCCGCCACTGGTGGTATCAAGAAGCCCCAC
AGATTCAGACCTGGTACCGTCGCTCTCAGAGAAATCAGAAAGTACCAAAAGTCCACTGAT
TTGTTGATCAGAAAGCTCCCCTTCTAAAGATTGGTCAGAGATATTGCTCACGAATTCAAG
GCTGAACTCAGATTCTAATCTTCTGCCGTTCTTGCTCTCCAAGAAGCTGCTGAAGCTTAC
CTCGTCGGTCTCTTCGAAGATACCAACTTGTGCGCTATCCACGCTAGAAGAGTTACTATT
ATGACCAAGGATATGCAACTCGCTAGAAGAATTAGAGGTGAAAGATTCTGA