Identifiers and Description

Gene Model Identifier

TTHERM_00188500

Standard Name

GTR4 (Glucose TRansport 4)

Aliases

PreTt08600 | 15.m00311 | 3697.m00023 | GTP4

Description

Major facilitator superfamily protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00898 ) cation transport protein
  • ( TIGR00880 ) Multidrug resistance protein
  • ( PF06930 ) Protein of unknown function (DUF1282)
  • ( PF07690 ) transporter, major facilitator family
  • ( PF00083 ) transporter, major facilitator superfamily
  • ( TIGR00879 ) MFS transporter, sugar porter (SP)
  • ( TIGR00791 ) transporter, gluconate:H+ symporter (GntP) family
  • ( TIGR00023 ) acyl-phosphate glycerol 3-phosphate acyltransferase
  • ( TIGR00895 ) MFS transporter, aromatic acid:H+ symporter
  • ( TIGR00883 ) MFS transporter, metabolite:H+ symporter (MHS)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00188500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02320.12.000147820282363e-173sugar transporter (527 aa)
OxytrichaContig12280.0.g233.0011931572567413e-53Sugar (and other) transporter
DictyBaseDDB_G02782611.9993007828132465e-27DDB_G0278261 on chromosome: 3
position 577308 to 579437
SGDYDL194W3.0007793728221555e-22SNF3 Plasma membrane low gluco
se sensor that regulates gluco
se transport; contains 12 pred
icted transmembrane segments a
nd a long C-terminal tail requ
ired for induction of hexose t
ransporters; also senses fruct
ose and mannose; similar to Rg
t2p
WormBaseWBGene000199799.995317835403734e-19status:Partially_confirmed U
niProt:O44616 protein_id:CCD
68888.1
Stentor CoeruleusSteCoe_20751.1548224173015786e-17

General Information

Paragraph NoGene NameParagraph Text
27GTR4GTP4 has only one known functional domain and is a member of the sugar transporter family, a subset of the major facilitator superfamily (E-value: 5.4e-36). This protein appears to be responsible for transporting sugar across the plasma membrane in response to changes in the electrochemical gradient, specifically in sugar uptake. Paragraph by: Kathleen Beardsworth and Kristen Keller (undergraduates), Keck Science Department, Claremont Colleges.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00188500(coding)
ATGAAAAGTCCATCAAGCTTAAATAATATGGATATCACAACTGAAGATGGCTAAAAATCT
TCTAAAAAATAGGAAGAATAGGAATATATATCGTTTTTGTATATATTAATTAATGTAATT
GTTTCGAATCTAGGAATTTTATATTTTGGATACCACCTCTCAGTTATGTCTTTAGCTTAA
GATACCGTTTTTACTGTATTTGAAGTTAAAGAAAGTTAACATAACTTCTACTCTTCTCTT
CTTGCTGCTGCTATTCCTTTTGGAGCTATATTTGGAGCAATCATACCTGGTAGCTTTCTT
TCTAATAGCTCCAGAAAAAACTCTATGATTTTTGCTGATGCTATTGGAACCATTTTTGGA
CTCTTAGTCTTAACTCGTGATATAAATATGCTTGTTTTAGCAAGACTATGTGCAGGATTT
GTCATAGGACTAAATAGCTCACTTGTTCTTAAATATGTAAATGAAATTACTCCAATTAGT
TTAACAGGAGTTATGGGTATAGTCTTTAGTATATCTTTGACTTTAGGTATAGTTATAGCA
AGTTTAAATGGATAGTTTTTTAGTCAAAATCCTTCTTAAGAAGATTAATACTGCTTTTTT
GTACTATTATTTCCATTAATATTTACTATTAGCCGTCCTATCTTATTTTAAGTTTTCTTC
AATCACGAAACTCCTTTTTATTACATCCTTAACAACCAACCTGATAGCTGCAAATAATTA
CTACAAATATTATATAAATCTCAATATGTTGACAAAATACTTTTAGAAGTTTAGTAAGAA
GTAATTAAGCAAGGCAGCAAAGACACTTCCAAGAGTTATAATATTAAGCGCTTGTTCATA
GGATGTACCTTGCTAATATTTTAGTAGTTTTCTGGAATAAATGCAGTTATTATGTTTTTA
GGTTAAATATTTTAAAAAGAACATTTTTCATTTAGAATGACAAATTTACTTTCACTACTT
TCTAATTTTATTTACTTAATAGCCTCAATTCTTAGTACGTACTTTGTAAAAAAGTATACA
AGGAGAGCCATTCTTATAACAGGTTCTTCATTTGCTGGAATATTTCTGCTCCTATTAGCT
CTTTTATAAATTATTGACATATAATAAATTTCTTTTCTTGCATTTTTTTTTATTAGCTGT
TACTTTGTTGCCTTCAACTTTTCTCTTGGCCCTGTCATTTGGTTATATAGTTCAGAAATT
CTTTCATCTAAAGAATTTAGCATAGCTACAACATTGAACTGGATAAGTGCAACAATAGTA
GTTGTTTCAATACCATATTTTGATCATTTGTGGCCACTATTCATTTTTTTCTCTGTTGTT
TGCTTTTCTTGTGCAACCTTCACTTTATTCTTGGTTAAAGAAACTAAAGATAAAAGCAAA
TTAGAGATACTTCATTTATATGATCCTTAACAAAAAGATCAAGGTGAGTATTCTAGTATT
GCTTTAAACACTTCTGATCAAAAAAATTACGTAGACTGA


>TTHERM_00188500(protein)
MKSPSSLNNMDITTEDGQKSSKKQEEQEYISFLYILINVIVSNLGILYFGYHLSVMSLAQ
DTVFTVFEVKESQHNFYSSLLAAAIPFGAIFGAIIPGSFLSNSSRKNSMIFADAIGTIFG
LLVLTRDINMLVLARLCAGFVIGLNSSLVLKYVNEITPISLTGVMGIVFSISLTLGIVIA
SLNGQFFSQNPSQEDQYCFFVLLFPLIFTISRPILFQVFFNHETPFYYILNNQPDSCKQL
LQILYKSQYVDKILLEVQQEVIKQGSKDTSKSYNIKRLFIGCTLLIFQQFSGINAVIMFL
GQIFQKEHFSFRMTNLLSLLSNFIYLIASILSTYFVKKYTRRAILITGSSFAGIFLLLLA
LLQIIDIQQISFLAFFFISCYFVAFNFSLGPVIWLYSSEILSSKEFSIATTLNWISATIV
VVSIPYFDHLWPLFIFFSVVCFSCATFTLFLVKETKDKSKLEILHLYDPQQKDQGEYSSI
ALNTSDQKNYVD


>TTHERM_00188500(gene)
ATGAAAAGTCCATCAAGCTTAAATAATATGGATATCACAACTGAAGATGGCTAAAAATCT
TCTAAAAAATAGGAAGAATAGGAATATATATCGTTTTTGTATATATTAATTAATGTAATT
GTTTCGAATCTAGGAATTTTATATTTTGGATACCACCTCTCAGTTATGTCTTTAGCTTAA
GATACCGTTTTTACTGTATTTGAAGTTAAAGAAAGTTAACATAACTTCTACTCTTCTCTT
CTTGCTGCTGCTATTCCTTTTGGAGCTATATTTGGAGCAATCATACCTGGTAGCTTTCTT
TCTAATAGCTCCAGAAAAAACTCTATGATTTTTGCTGATGCTATTGGAACCATTTTTGGA
CTCTTAGTCTTAACTCGTGATATAAATATGCTTGTTTTAGCAAGACTATGTGCAGGATTT
GTCATAGGACTAAATAGCTCACTTGTTCTTAAATATGTAAATGAAATTACTCCAATTAGT
TTAACAGGAGTTATGGGTATAGTCTTTAGTATATCTTTGACTTTAGGTATAGTTATAGCA
AGTTTAAATGGATAGTTTTTTAGTCAAAATCCTTCTTAAGAAGATTAATACTGCTTTTTT
GTACTATTATTTCCATTAATATTTACTATTAGCCGTCCTATCTTATTTTAAGTTTTCTTC
AATCACGAAACTCCTTTTTATTACATCCTTAACAACCAACCTGATAGCTGCAAATAATTA
CTACAAATATTATATAAATCTCAATATGTTGACAAAATACTTTTAGAAGTTTAGTAAGAA
GTAATTAAGCAAGGCAGCAAAGACACTTCCAAGAGTTATAATATTAAGCGCTTGTTCATA
GGATGTACCTTGCTAATATTTTAGTAGTTTTCTGGAATAAATGCAGTTATTATGTTTTTA
GGTTAAATATTTTAAAAAGAACATTTTTCATTTAGAATGACAAATTTACTTTCACTACTT
TCTAATTTTATTTACTTAATAGCCTCAATTCTTAGTACGTACTTTGTAAAAAAGTATACA
AGGAGAGCCATTCTTATAACAGGTTCTTCATTTGCTGGAATATTTCTGCTCCTATTAGCT
CTTTTATAAATTATTGACATATAATAAATTTCTTTTCTTGCATTTTTTTTTATTAGCTGT
TACTTTGTTGCCTTCAACTTTTCTCTTGGCCCTGTCATTTGGTTATATAGTTCAGAAATT
CTTTCATCTAAAGAATTTAGCATAGCTACAACATTGAACTGGATAAGTGCAACAATAGTA
GTTGTTTCAATACCATATTTTGATCATTTGTGGCCACTATTCATTTTTTTCTCTGTTGTT
TGCTTTTCTTGTGCAACCTTCACTTTATTCTTGGTTAAAGAAACTAAAGATAAAAGCAAA
TTAGAGATACTTCATTTATATGATCCTTAACAAAAAGATCAAGGTGAGTATTCTAGTATT
GCTTTAAACACTTCTGATCAAAAAAATTACGTAGACTGA