Identifiers and Description

Gene Model Identifier

TTHERM_00185640

Standard Name

JMJ1 (JMJC domain-encoding 1)

Aliases

PreTt29886 | 14.m00453

Description

JMJ1 JmjC domain protein; JmjC domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF02373 ) JmjC domain
  • ( PF09022 ) Staphostatin A
  • ( PF08323 ) Starch synthase catalytic domain
  • ( PF05864 ) Chordopoxvirus DNA-directed RNA polymerase 7

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00185640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09915.19.997093137033517e-262jmjC domain-containing protein
(1133 aa)
WormBaseWBGene000090899.995317835403734e-19locus:jmjd-3.2 status:Partia
lly_confirmed UniProt:Q19760
protein_id:CAA94916.1
Stentor CoeruleusSteCoe_211854.248354255291589e-18

General Information

Paragraph NoGene NameParagraph Text
115COI6,
JMJ1,
LIA5,
COI7
Coi6p, its interaction partners Coi7p and Lia5p, and the histone demethylase Jmj1p are crucial for confining the production of small RNAs and the formation of heterochromatin to the eliminated sequences. The loss of Coi6p, Coi7p or Jmj1p causes ectopic DNA elimination.

Associated Literature

  1. Ref:29021213: Noto T, Mochizuki K (2017) Whats, hows and whys of programmed DNA elimination in Tetrahymena. Open biology 7(10):
  2. Ref:28273462: Suhren JH, Noto T, Kataoka K, Gao S, Liu Y, Mochizuki K (2017) Negative Regulators of an RNAi-Heterochromatin Positive Feedback Loop Safeguard Somatic Genome Integrity in Tetrahymena. Cell reports 18(10):2494-2507
  3. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  4. Ref:22427430: Chung PH, Yao MC (2012) Tetrahymena thermophila JMJD3 homolog regulates H3K27 methylation and nuclear differentiation. Eukaryotic cell 11(5):601-14

Sequences

>TTHERM_00185640(coding)
ATGAATCTTAGGAACAAGAGAAAGGTTTCTTCAAGTACTAGCGAAGAAAAAGACTAACAC
TTTAGTTCTAGCCTGATTTAAACTAATGAAAATATAAATTCGAATGCAACAACTTCGGTC
AATATCGATTCTACTGCAGCATACAATATTTCTTAGGAAAAAGAAGGTTCTCCTAAAAAG
AATGGATTGGCAGCTAACTCCAGCAGCACTTTCGTCTCCACAACTGACTAAATCCTAATA
AATGGAAACAACGTATCAAAGAAAATCAAGACAAATAGCGGTGCTGCATTTCAAACTTAA
GTTTCTGCGAATGCTCCTTGCTTAAAATCAGCAGAACAAATTATTTAGCATTAGTAGAAT
GTTAATAATGATTGTGATATTGACTGCGATGGATTTCGCGAAATATTTCCTGAAGACCTA
CACACATAGTTGTAGGAAGCAATTTATAAAGAATAAACCATCGTTTTGAGAGAAGCAGCT
GGCCCTAAAGGTTTTAATGTGAACCCCAAAAACTTATTTAGCTTTGAAAGTGTGATTAAA
AATCATAGCGATATGTAAATTGACTGTAGAGTTTAAAATCCTACAGTTTATGGCTTTAAT
GTTTTAAATCCCAAAAACCAATAGCATGTCTACAATACCACCATTTAGGAATACGGAGAG
TATGCTGCATTGCTTTAAGAAGACAGGTACGAAGAAATTAAGAAAAAACCATATTACAAA
GAATACTTTAGCAAACTATCTAACGGAGTAATGTTTGCTGTAAACATTGACATGGATGAT
TTTAATTGGTAAACCGAAAACATGCGTCTGAGATCAGGGCTTCCCCATTACCTCCTAAAT
AAAGGCAAACATGATATCCTTAGCTACCATAGGTAAAACGTTATGGGATGCACTCAACCT
TAAATGTACCTAAAAGTCGCTGGAGTGTGGACTGGAGGACACCAAGAGAACATCTCTGTC
AGAGCTATAAATATCAACCACGGAGATGGTGACAGTGATTGGTATTGCGTCGATTTTGAC
TAAGTAGAAAAGTATAGAAATTATGTGAAAAGAAAATATTAAGTTGATATACATGGCGAT
GAAGGTCTATGGTTCGGAAAGTATAATGACCCAGATGTTATCAAAGCAGGGATCAGGATA
AAAAAAGTTATTTAAAGAAAAAATGATATTGTCATTTTAGCTCCTGGAGTTTTGCATTGG
GTACGCTGCAGAGGTAGAAGTGTGTAAACTGCATGGAATTTTGCTTACAGAAGGATTGAA
GACATAATTGCTATGAATGAAAGATTTTTGTATAATTAAAAAATCAACTTTGAAACAATA
ATATTGAATAAATCTCTTTTTATGGATTTACTTAATTTTGAGTACCACAATTTACCTTTG
GAAGTAGCACAGAAATTGCATAGTATTGTCGCTGATTACTATTAGAAAGAATACTAATTT
GAACAAAATTTGACTCACTATCCATTTAAATGTAAGAACTAAGTGATTTTTTATGACTAA
ATGCCTGCTTAGCTTAAACACATCCAAATTTATTACTGCAGCTAAATAGGCTGTGGAAAA
GAAATATTTTGCTATTTCGGTATCCTCCGCTCTGAATTCTAATATCAAGAACCTAACAAT
AGCCTATTCCTTTCTTAAGATTTTTGTGGAAAGTATTTCTGTCCTCTTTGCATTTAGGAA
ATGAAAAAAATTGATGATTCTATAATACTTTTTAGAAAATTTGATCTAAATTCGTTGAAG
ACTTTGTTGAACAGAGTTTATAATTATATTTAGGAAGAAGGAAAGTAATAGTCTCTCTAC
CCTATTTCCGATTTAACCAACATTAGTCACTTCTGTGGTTAAATCGCTAACATAAATGAC
TTTGTTTTTAACAAAGACGTAAGGAGATTAGAGCAAGTTTACATTCCTGATGTCTTCGCC
TCATAGGGAGTCGAAGAAATGTAGAAATTTCAACTAGATTTGTAATCAGGAAGACTTATC
GATTTTATTGAGAAACCTATTATGAAATTTATTGCACCTAACTAGCAGTAGAGATGTCAA
GATATTATGCATGATGGTGAGGATGATTAGGAGAAAGATAGTCAATAAGTTAAGATAGAA
GATGCTGGTAAAAAAGAAGATGATAGTTTGGTTTCTAATAGTCAATAAGTTAAATCAGCT
AATAAGAATAAAGTTCAGTAGTAGCAACAATAATAAATTGCTACTCAATTAACAAACTAA
GAATTAAAAGAAAATTTGAAAAATGGATAGATATAGCAGAAGTAGTTATCTTTGAATTTT
GAATCAGTAGAAAATAACGATTTAAGCCAAAACAAAAATACAAATGTAAATAGTTAATAT
TAATAAAGTGAATTACCAAATAAACCAAATAAACAACAACTTTCATCATTATAAAATAAA
TAGTTTTAAAATGAATTTTAAATTTAAAATCAACTTTGCAACAACTATTCAAAATGCAAC
TTAGAAAATGATTATTAAACTGATTCAAAAAATAACTTTTCTTCTATATCTTCTATTTAA
TAGCAACATGACGATGAAAAATATGCAATATAGTTGCAATAAGAATTGGACTACATGGGT
TCTAAGACTCGCAAATAAAAAAACAATTCTCAGCTCCTCATTTCTCATGATTATGAAATA
TCTTCACTCACTCAATCTTCGAGAGTTCTAAGAGGAGGGAGATCTCTTTGTTCTAAACCT
CCCTCACAAAACTAAAGAAAAAAAGCTCAGTAAAACAAAATCACAAGCTTGAAATCTATA
TCTGAGTCTAATGACAGCTCAAAATAAAGCTCCAAACAGAACCCAAATGAGGCTTAATCA
CCCACTTCATCATCTACTACAATTGGTGTTTCAACAAATTTAGCTAGTCCCTCACTTTAA
GCTCAATAAAATATCAAGACTAAAATAGAACAAACTAATGTATTACCTTCAGATTCTTAA
ATGGTGATAGAAGAATAACCCTCAACACCATAACAATAAATAGATGATGAAAGTAGCTTT
TAATTTTCTTAAAAAATTAATTATAAAATAGTAAGCAGGAGTAACAGCAATTCGTGCAAA
AAAAGCTAATTGAACACACAGACTACTAGCTAGTAAAATAAAACTATTGATGAAAACAAA
AAAATTAAAATCAAAGGCTATATTTCAGATGACGATGATGCTAATGACCAAGAAGAAATA
GAAAAACAAAGAATAAGAAAAGAGCGCGAATAGCAAAGAGTAAAAATGTTGGAATAGTTG
GAAAAAAGTTAAAAAGAGAAAGAATCTGAGACTAAATAAATCACTAAAGAAACTAAATAA
TAAAAAACTCCTTCAAGTGACTATGAAGATAATCCAAATATTTATAAAAGAAGATTAAAC
TTAAAATAAATTACTAATAGCTCAAACTGA


>TTHERM_00185640(protein)
MNLRNKRKVSSSTSEEKDQHFSSSLIQTNENINSNATTSVNIDSTAAYNISQEKEGSPKK
NGLAANSSSTFVSTTDQILINGNNVSKKIKTNSGAAFQTQVSANAPCLKSAEQIIQHQQN
VNNDCDIDCDGFREIFPEDLHTQLQEAIYKEQTIVLREAAGPKGFNVNPKNLFSFESVIK
NHSDMQIDCRVQNPTVYGFNVLNPKNQQHVYNTTIQEYGEYAALLQEDRYEEIKKKPYYK
EYFSKLSNGVMFAVNIDMDDFNWQTENMRLRSGLPHYLLNKGKHDILSYHRQNVMGCTQP
QMYLKVAGVWTGGHQENISVRAININHGDGDSDWYCVDFDQVEKYRNYVKRKYQVDIHGD
EGLWFGKYNDPDVIKAGIRIKKVIQRKNDIVILAPGVLHWVRCRGRSVQTAWNFAYRRIE
DIIAMNERFLYNQKINFETIILNKSLFMDLLNFEYHNLPLEVAQKLHSIVADYYQKEYQF
EQNLTHYPFKCKNQVIFYDQMPAQLKHIQIYYCSQIGCGKEIFCYFGILRSEFQYQEPNN
SLFLSQDFCGKYFCPLCIQEMKKIDDSIILFRKFDLNSLKTLLNRVYNYIQEEGKQQSLY
PISDLTNISHFCGQIANINDFVFNKDVRRLEQVYIPDVFASQGVEEMQKFQLDLQSGRLI
DFIEKPIMKFIAPNQQQRCQDIMHDGEDDQEKDSQQVKIEDAGKKEDDSLVSNSQQVKSA
NKNKVQQQQQQQIATQLTNQELKENLKNGQIQQKQLSLNFESVENNDLSQNKNTNVNSQY
QQSELPNKPNKQQLSSLQNKQFQNEFQIQNQLCNNYSKCNLENDYQTDSKNNFSSISSIQ
QQHDDEKYAIQLQQELDYMGSKTRKQKNNSQLLISHDYEISSLTQSSRVLRGGRSLCSKP
PSQNQRKKAQQNKITSLKSISESNDSSKQSSKQNPNEAQSPTSSSTTIGVSTNLASPSLQ
AQQNIKTKIEQTNVLPSDSQMVIEEQPSTPQQQIDDESSFQFSQKINYKIVSRSNSNSCK
KSQLNTQTTSQQNKTIDENKKIKIKGYISDDDDANDQEEIEKQRIRKEREQQRVKMLEQL
EKSQKEKESETKQITKETKQQKTPSSDYEDNPNIYKRRLNLKQITNSSN


>TTHERM_00185640(gene)
ATGAATCTTAGGAACAAGAGAAAGGTTTCTTCAAGTACTAGCGAAGAAAAAGACTAACAC
TTTAGTTCTAGCCTGATTTAAACTAATGAAAATATAAATTCGAATGCAACAACTTCGGTC
AATATCGATTCTACTGCAGCATACAATATTTCTTAGGAAAAAGAAGGTTCTCCTAAAAAG
AATGGATTGGCAGCTAACTCCAGCAGCACTTTCGTCTCCACAACTGACTAAATCCTAATA
AATGGAAACAACGTATCAAAGAAAATCAAGACAAATAGCGGTGCTGCATTTCAAACTTAA
GTTTCTGCGAATGCTCCTTGCTTAAAATCAGCAGAACAAATTATTTAGCATTAGTAGAAT
GTTAATAATGATTGTGATATTGACTGCGATGGATTTCGCGAAATATTTCCTGAAGACCTA
CACACATAGTTGTAGGAAGCAATTTATAAAGAATAAACCATCGTTTTGAGAGAAGCAGCT
GGCCCTAAAGGTTTTAATGTGAACCCCAAAAACTTATTTAGCTTTGAAAGTGTGATTAAA
AATCATAGCGATATGTAAATTGACTGTAGAGTTTAAAATCCTACAGTTTATGGCTTTAAT
GTTTTAAATCCCAAAAACCAATAGCATGTCTACAATACCACCATTTAGGAATACGGAGAG
TATGCTGCATTGCTTTAAGAAGACAGGTACGAAGAAATTAAGAAAAAACCATATTACAAA
GAATACTTTAGCAAACTATCTAACGGAGTAATGTTTGCTGTAAACATTGACATGGATGAT
TTTAATTGGTAAACCGAAAACATGCGTCTGAGATCAGGGCTTCCCCATTACCTCCTAAAT
AAAGGCAAACATGATATCCTTAGCTACCATAGGTAAAACGTTATGGGATGCACTCAACCT
TAAATGTACCTAAAAGTCGCTGGAGTGTGGACTGGAGGACACCAAGAGAACATCTCTGTC
AGAGCTATAAATATCAACCACGGTAAATACAAGATTCAATTTACTTTTGATAAATTTATG
AATTTATCTAAAATTTTGTTTCCATTAAGCTTGTTTTTTGATATATATTCTACCTATCCA
TCCATCCACCAATCCAACAATATAAATCCTATCACTCCATCTAAATAATTTTCTTTAGAC
CAAAAAAGCAAACAAAAAAATAAATAAATAAATAAATAATATCTCTCTTCAAATTTAAAG
ACCATAATAATCAAACAATCTTGATTGATTAAATTTTAGTTTATTTTTAAATAACTACTA
GCAAAGCTAGAACTTAAAATTGAATCTTGCATATTTTTGGAAGATTAAATTATCAAAGGT
TATTAATTCGCAGTCAGCATAAAAATTGTTAGTTTTGAATTTGAACATTAATTAGTTGTA
AATAATTATCAAGCAAACTTTTGAATTTTGCTTCCCCCTTTTTATTTCAATTTATTATTA
AAGTAAAATTGAAGTCCAAAATAATTAGTTTCTAAATTCAATTTTGACTTAATATTAATT
AGTAAAAATAACTTACAATTTTTGAACAATTTTTACTTAATTAATTAATTTACAAGCCTG
ATTTATTTTGGTCAAATTAATAAAATCAATAATCAAATTTTAATAAATATTTAAATGTTA
ATGCAAATAAATATTTTACTTTAAATTCAAGAGGATATTTTTCAATTAAAAATTTTAATT
TAATTACAACATAAATTTATTTAATTAAAATATTTTTTATTTATTAAATAGGAGATGGTG
ACAGTGATTGGTATTGCGTCGATTTTGACTAAGTAGAAAAGTATAGAAATTATGTGAAAA
GAAAATATTAAGTTGATATACATGGCGATGAAGGTCTATGGTTCGGAAAGTATAATGACC
CAGATGTTATCAAAGCAGGGATCAGGATAAAAAAAGTTATTTAAAGAAAAAATGATATTG
TAAGTTTAATTTAAAAAGATTAATATGATATTTAAATTTTGATTATGATTAATTAATTAG
ATTTTTAATTTTATAAATTATGCTAATTTTATTTTATCATTTAAGGTCATTTTAGCTCCT
GGAGTTTTGCATTGGGTACGCTGCAGAGGTAGAAGTGTGTAAACTGCATGGAATTTTGCT
TACAGAAGGATTGAAGACATAATTGCTATGAATGAAAGATTTTTGTATAATTAAAAAATC
AACTTTGAAACAATAATATTGAATAAATCTCTTTTTATGGATTTACTTAATTTTGAGTAC
CACAATTTACCTTTGGAAGTAGCACAGAAATTGCATAGTATTGTCGCTGATTACTATTAG
AAAGAATACTAATTTGAACAAAATTTGACTCACTATCCATTTAAAGTAAAATATTTGAAA
AAATTTATATCAAATAACAATTTTTTAATGTATTTTTTCAAGTGTAAGAACTAAGTGATT
TTTTATGACTAAATGCCTGCTTAGCTTAAACACATCCAAATTTATTACTGCAGCTAAATA
GGCTGTGGAAAAGAAATATTTTGCTATTTCGGTATCCTCCGCTCTGAATTCTAATATCAA
GAACCTAACAATAGCCTATTCCTTTCTTAAGATTTTTGTGGAAAGTATTTCTGTCCTCTT
TGCATTTAGGAAATGAAAAAAATTGATGATTCTATAATACTTTTTAGAAAATTTGATCTA
AATTCGTTGAAGACTTTGTTGAACAGAGTTTATAATTATATTTAGGAAGAAGGAAAGTAA
TAGTCTCTCTACCCTATTTCCGATTTAACCAACATTAGTCACTTCTGTGGTTAAATCGCT
AACATAAATGACTTTGTTTTTAACAAAGACGTAAGGAGATTAGAGCAAGTTTACATTCCT
GATGTCTTCGCCTCATAGGGAGTCGTAATTTAATCGCTTTAAAAATTTATCAAATTTTAT
TTTTCTAATTTAGCACATTTATTTCTTTATTTTAAAAAGGATTTAATTGAAAATTTTTTA
ATTTTTTAATCAATTTTAATTAGAAAATAAAATCTTATTTTATTTTTATCAAAATTTGTT
TTCATAATTGATTTATTTGATCAGCATTAAAAACAAACAAAAATTTTATTTTCATAATTA
GAGTTTTTTAGCAATATAATCAAAATCAATTATTTAATTTTAAATTAAACACTTTTACTC
AAATTTTTAATAAAAAAACCCTTTAATTTATTTAATCTACTCAAATAAAATTTAATAAAT
AATTTTTATCTATTAATTTAAATCCATAATTAATAAAGTTTTTTAATGAATTAACTAATT
AATTAATTAATTAATTGGTTGTATTTTTTTTACTAAACAAACAAATTAAAAAAAAGTTAG
AATTGTTTTTTGAATTAATATTTTTTAAATGAGATTTGAGAAAATTTTTATTGGTTTATT
TATTGAAAAACTTAAATAATTTATTTGATATGATTAGGAAGAAATGTAGAAATTTCAACT
AGATTTGTAATCAGGAAGACTTATCGATTTTATTGAGAAACCTATTATGAAATTTATTGC
ACCTAACTAGCAGTAGAGATGTCAAGATATTATGCATGATGGTGAGGATGATTAGGAGAA
AGATAGTCAATAAGTTAAGATAGAAGATGCTGGTAAAAAAGAAGATGATAGTTTGGTTTC
TAATAGTCAATAAGTTAAATCAGCTAATAAGAATAAAGTTCAGTAGTAGCAACAATAATA
AATTGCTACTCAATTAACAAACTAAGAATTAAAAGAAAATTTGAAAAATGGATAGATATA
GCAGAAGTAGTTATCTTTGAATTTTGAATCAGTAGAAAATAACGATTTAAGCCAAAACAA
AAATACAAATGTAAATAGTTAATATTAATAAAGTGAATTACCAAATAAACCAAATAAACA
ACAACTTTCATCATTATAAAATAAATAGTTTTAAAATGAATTTTAAATTTAAAATCAACT
TTGCAACAACTATTCAAAATGCAACTTAGAAAATGATTATTAAACTGATTCAAAAAATAA
CTTTTCTTCTATATCTTCTATTTAATAGCAACATGACGATGAAAAATATGCAATATAGTT
GCAATAAGAATTGGACTACATGGGTTCTAAGACTCGCAAATAAAAAAACAATTCTCAGCT
CCTCATTTCTCATGATTATGAAATATCTTCACTCACTCAATCTTCGAGAGTTCTAAGAGG
AGGGAGATCTCTTTGTTCTAAACCTCCCTCACAAAACTAAAGAAAAAAAGCTCAGTAAAA
CAAAATCACAAGCTTGAAATCTATATCTGAGTCTAATGACAGCTCAAAATAAAGCTCCAA
ACAGAACCCAAATGAGGCTTAATCACCCACTTCATCATCTACTACAATTGGTGTTTCAAC
AAATTTAGCTAGTCCCTCACTTTAAGCTCAATAAAATATCAAGACTAAAATAGAACAAAC
TAATGTATTACCTTCAGATTCTTAAATGGTGATAGAAGAATAACCCTCAACACCATAACA
ATAAATAGGTAAATAAATATGATTGATTTTAACCAAATACTAACTAACAAACAAACTAAA
TAATTCATGATGAAATTAATATTAGAAAAATGAATTTAAATTTTTTTAAAATTAGATGAT
GAAAGTAGCTTTTAATTTTCTTAAAAAATTAATTATAAAATAGTAAGCAGGAGTAACAGC
AATTCGTGCAAAAAAAGCTAATTGAACACACAGACTACTAGCTAGTAAAATAAAACTATT
GATGAAAACAAAAAAATTAAAATCAAAGGCTATATTTCAGATGACGATGATGCTAATGAC
CAAGAAGAAATAGAAAAACAAAGAATAAGAAAAGAGCGCGAATAGCAAAGAGTAAAAATG
TTGGAATAGTTGGAAAAAAGTTAAAAAGAGAAAGAATCTGAGACTAAATAAATCACTAAA
GAAACTAAATAATAAAAAACTCCTTCAAGTGACTATGAAGATAATCCAAATATTTATAAA
AGAAGATTAAACTTAAAATAAATTACTAATAGCTCAAACTGA