Identifiers and Description

Gene Model Identifier

TTHERM_00185200

Standard Name

None

Aliases

PreTt29842 | 14.m00409

Description

signal recognition particle receptor subunit alpha; SRP54-type protein- GTPase domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • SRP-dependent cotranslational protein targeting to membrane (IEA) | GO:0006614

Domains

  • ( PF07516 ) SecA Wing and Scaffold domain
  • ( PF00448 ) SRP54-type protein, GTPase domain
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF03413 ) Peptidase propeptide and YPEB domain
  • ( TIGR00959 ) signal recognition particle protein
  • ( PF02881 ) SRP54-type protein, helical bundle domain
  • ( TIGR01425 ) signal recognition particle protein SRP54
  • ( PF01656 ) CobQ/CobB/MinD/ParA nucleotide binding domain
  • ( TIGR00064 ) signal recognition particle-docking protein FtsY
  • ( PF04086 ) Signal recognition particle, alpha subunit,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 25%

TetraMine Data

TTHERM_00185200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09936.19.997093137033517e-262SRP54-type protein, GTPase dom
ain-containing protein (615 aa
)
OxytrichaContig2103.0.g72.998986826334339e-156SRP54-type protein, GTPase dom
ain
WormBaseWBGene000095216.0025840010353464e-108status:Partially_confirmed U
niProt:G4RYA5 protein_id:CCD
63963.1
DictyBaseDDB_G02773772.000234809436283e-103srpR on chromosome: 2 position
7920699 to 7922764
SGDYDR292C1.0004460510701209e-64SRP101 Signal recognition part
icle (SRP) receptor alpha subu
nit; contain GTPase domains; i
nvolved in SRP-dependent prote
in targeting; interacts with t
he beta subunit, Srp102p
Stentor CoeruleusSteCoe_86791.5400882849875202e-51

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00185200(coding)
ATGATTGAATTAGCTTGCATTTTTACAACTAGTGGTGTTATATTATTTTATAAGGCATTT
TCTACTTTGAGATACGATTTAGTAGATGACTTAATCAAAAAGAACTTAATTAACGAAAGA
TTTAGCGAGTAGAGCTATTTGTTGGACAATTATAGAGTTATGTGGACTAGAGATTAAGAG
AGAAATCTCGTTTTTATGATAGCTTATAGCGAGTTATTACATCTTTAGTCAACTGATAAG
TTTATTAAGCTTTTAAAGGCTATCTATGTTGAAGATTACTACAACTAAATTAAAATTGAA
AACCACGTTATCAAAGAAATTCCATCTTTTGATAAGGGATTCGAATAGAGTGTCATGAAA
TGGTAAGAATACTTGAAAGTCGAAAGGGAAAGATAAAAATCAACTATGAAATCCTTTGAA
GAAACAAAGAAAGGATAAGAACTTAAAAAGGGAGCAAGCGGGGTCTAGAAAAAAAAACCA
GGCAAGGTTGGTACTGAAAAAGACGAGTACACTCCTTCTGGAAACAGCGCATTAAATAAT
AGTGTTGGCAGTGTTGGAAGCTATAATTCAATTGATTCTGCAGATGAATCTAAAACAGAT
GCCAAAAGAAACAGTATTGATAGTTCTGAATAATCAGAAATAGAAAAAGCTAGACTTTTG
TTGAAACAGAAATTTGAAAAGCCAAAAAAAGAACCTACTCCTGTTGAAAAACCAGTAGTT
GAATAGAAAAAGTAAAAGGATAAAGCAGTAGGAACTGCTGGAAAATATAGTAGCTAATTA
GCTAAACAATTAGATCAAAGTTCGAACAAATAAGAAGAAGATATTAACTTAGAAAAGCAA
AAGTACTTAGGAGGCGAAAATGAAAAAATAAAAGGTTTTGATGATATTTCTTCAGACGAA
GATGAGTAGGAAGTAGAAAAAAGAGGTTTCTTCTCTAAAATCGTCAGCAATTTTAAGTAA
CTTACTGGTACCAAGATATTAGATGCTTAGGATTTACAGCCTATTCTTGACAAGTTCAAA
GAGTAATTGATGAATAAAAATGTTGGTGAATAAATTGCATAATAGTTATGTGATAGCATC
AAAAAGAATTTAATTAACACTCAAGCAAAAGCTTTAACCTTGCTTAATAAAACCGTTAAG
GAATCATTATAAGACGCTATCAGCAAGATTTTAACACCAAAGAGAAATATTGATATTATT
GCCGAAGCAATGAGATCAAGAGAAAAGGGAAAACCATATATCATAACATTTATTGGTGTC
AATGGTGTTGGTAAATCAACAAACCTTGCAAAAGTTGCATATCTCTTTAAGAAAGAAGGT
TTTTCTGTCATGTTTGCTGCTTGCGATAATTTCAGAGCTGGTGCAGTAGAATAAATTAAA
ACTCATGGTAGATGTTTAGAAATACCTGTATTTGACAGAGGTTACAAAGATGAACCTGCT
GATATTGCTTTCTAAGCCATCAGAGAAGCTTAAGCAAAGAAAGTTGATGTATTACTTATT
GATACTGCTGGTCGTATGTAAGATAATGAACCTTTAATGAAGCAACTCAGTACTCTTGTT
GTCTAAAATAATCCTGATCTTATTGTTTTCATTGGTGAAGCTTTAGTTGGTAATGATGGT
ACTGATTAATTAATGAAATTCAACAAAGCTCTTATCGATCTCTCCCCAAAAGACAGAATC
AGAGAAATCGATGCCATTATCTTAAGTAAATTCGACACTGTCGACGACAAAGTTGGAGCT
GCTTTAAGTATGACTTATAACACTGGTAAGCCTATTCTATTCTGTGGTGTAGGATAAAAA
TACACTCACCTTAAAAAACTCAATGTTAGAACTGTAGTTCATGCCTTGCTAGATTGA


>TTHERM_00185200(protein)
MIELACIFTTSGVILFYKAFSTLRYDLVDDLIKKNLINERFSEQSYLLDNYRVMWTRDQE
RNLVFMIAYSELLHLQSTDKFIKLLKAIYVEDYYNQIKIENHVIKEIPSFDKGFEQSVMK
WQEYLKVERERQKSTMKSFEETKKGQELKKGASGVQKKKPGKVGTEKDEYTPSGNSALNN
SVGSVGSYNSIDSADESKTDAKRNSIDSSEQSEIEKARLLLKQKFEKPKKEPTPVEKPVV
EQKKQKDKAVGTAGKYSSQLAKQLDQSSNKQEEDINLEKQKYLGGENEKIKGFDDISSDE
DEQEVEKRGFFSKIVSNFKQLTGTKILDAQDLQPILDKFKEQLMNKNVGEQIAQQLCDSI
KKNLINTQAKALTLLNKTVKESLQDAISKILTPKRNIDIIAEAMRSREKGKPYIITFIGV
NGVGKSTNLAKVAYLFKKEGFSVMFAACDNFRAGAVEQIKTHGRCLEIPVFDRGYKDEPA
DIAFQAIREAQAKKVDVLLIDTAGRMQDNEPLMKQLSTLVVQNNPDLIVFIGEALVGNDG
TDQLMKFNKALIDLSPKDRIREIDAIILSKFDTVDDKVGAALSMTYNTGKPILFCGVGQK
YTHLKKLNVRTVVHALLD


>TTHERM_00185200(gene)
ATGATTGAATTAGCTTGCATTTTTACAACTAGTGGTGTTATATTATTTTATAAGGCATTT
TCTACTTTGAGATACGATTTAGTAGATGACTTAATCAAAAAGAACTTAATTAACGAAAGA
TTTAGCGAGTAGAGCTATTTGTTGGACAATTATAGAGTTATGTGGACTAGAGATTAAGAG
AGAAATCTCGTTTTTATGATAGCTTATAGCGAGTTATTACATCTTTAGTCAACTGATAAG
TTTATTAAGCTTTTAAAGGCTATCTATGTTGAAGATTACTACAACTAAATTAAAATTGAA
AACCACGTTATCAAAGAAATTCCATCTTTTGATAAGGGATTCGAATAGAGTGTCATGAAA
TGGTAAGAATACTTGAAAGTCGAAAGGGAAAGATAAAAATCAACTATGAAATCCTTTGAA
GAAACAAAGAAAGGATAAGAACTTAAAAAGGGAGCAAGCGGGGTCTAGAAAAAAAAACCA
GGCAAGGTTGGTACTGAAAAAGACGAGTACACTCCTTCTGGAAACAGCGCATTAAATAAT
AGTGTTGGCAGTGTTGGAAGCTATAATTCAATTGATTCTGCAGATGAATCTAAAACAGAT
GCCAAAAGAAACAGTATTGATAGTTCTGAATAATCAGAAATAGAAAAAGCTAGACTTTTG
TTGAAACGTAAATAAATAAATTGAATTTTCACTAAAAAACATTTTTTTTTCATTTTTTAT
CTAGAGAAATTTGAAAAGCCAAAAAAAGAACCTACTCCTGTTGAAAAACCAGTAGTTGAA
TAGAAAAAGTAAAAGGATAAAGCAGTAGGAACTGCTGGAAAATATAGTAGCTAATTAGCT
AAACAATTAGATCAAAGTTCGAACAAATAAGAAGAAGATATTAACTTAGAAAAGCAAAAG
TACTTAGGAGGCGAAAATGAAAAAATAAAAGGTTTTGATGATATTTCTTCAGACGAAGAT
GAGTAGGAAGTAGAAAAAAGAGGTTTCTTCTCTAAAATCGTCAGCAATTTTAAGTAACTT
ACTGGTACCAAGGTAAAAAAAATATAAGAATCAATAAAAATTTTAGTTAAAAAAAGAAAG
AAAAGAAATAAACTTTATCTTTTTGTTCTTTAAAGGCTGAAAATCATATCAGATTTAAGC
AAGTGTTCAAAATATTGTTTCTAACTTTTAATTTATAAATATAGATATTAGATGCTTAGG
ATTTACAGCCTATTCTTGACAAGTTCAAAGAGTAATTGATGAATAAAAATGTTGGTGAAT
AAATTGCATAATAGTTATGTGATAGCATCAAAAAGAATTTAATTAACACTCAAGCAAAAG
CTTTAACCTTGCTTAATAAAACCGTTAAGGAATCATTATAAGACGCTATCAGCAAGATTT
TAACACCAAAGAGAAATATTGATATTATTGCCGAAGCAATGAGATCAAGAGAAAAGGGAA
AACCATATATCATAACATTTATTGGTGTCAATGGTGTTGGTAAATCAACAAACCTTGCAA
AAGTTGCATATCTCTTTAAGAAAGAAGTAATTACTTTATTCAATTAATTTAAATGTAAAA
ATAAACTAATCCAAAAACACATTAAAAATATTTTGATTAAATAAATGAATGCAAAAAAGC
ATCAATTTTAATTCAATTTATTAATAAAAAAGTCCATTTAATTATTTTTAAAATTTAAAA
TTTAAATTTATGTTTTTATTAAAATCATTTTTTTATTTAAAAAAGGGTTTTTCTGTCATG
TTTGCTGCTTGCGATAATTTCAGAGCTGGTGCAGTAGAATAAATTAAAACTCATGGTAGA
TGTTTAGAAATACCTGTATTTGACAGAGGTTACAAAGATGAACCTGCTGATATTGCTTTC
TAAGCCATCAGAGAAGCTTAAGCAAAGAAAGTTGATGTATTACTTATTGATACTGCTGGT
CGTATGTAAGATAATGAACCTTTAATGAAGCAACTCAGTACTCTTGTTGTCTAAAATAAT
CCTGATCTTATTGTTTTCATTGGTGAAGCTTTAGTTGGTAATGATGGTACTGATTAATTA
ATGAAATTCAACAAAGCTCTTATCGATCTCTCCCCAAAAGACAGAATCAGAGAAATCGAT
GCCATTATCTTAAGTAAATTCGACACTGTCGACGACAAAGGTATAACTTAATTTATTTAA
AAATGGTTATCTCATTTTTGTTTATAATTAAATAATAGTTGGAGCTGCTTTAAGTATGAC
TTATAACACTGGTAAGCCTATTCTATTCTGTGGTGTAGGATAAAAATACACTCACCTTAA
AAAACTCAATGTTAGAACTGTAGTTCATGCCTTGCTAGATTGA