Identifiers and Description

Gene Model Identifier

TTHERM_00161060

Standard Name

None

Aliases

PreTt28498 | 13.m00457 | 3829.m01319 | RPS12

Description

Ribosomal protein L7Ae containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01248 ) Ribosomal protein L7Ae

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00161060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05363.17.99824663097029e-79ribosomal protein L7Ae contain
ing protein (127 aa)
OxytrichaContig21441.0.g881.000116773704384e-19Ribosomal protein L7Ae/L30e/S1
2e/Gadd45 family
WormBaseWBGene000044819.995317835403734e-19locus:rps-12 40S ribosomal p
rotein S12 status:Confirmed
UniProt:P49196 protein_id:
CCD61763.1
DictyBaseDDB_G02842371.999598840915195e-17rps12 on chromosome: 4 positio
n 1729814 to 1730224
SGDYOR369C0.000000600201742947405RPS12 Protein component of the
small (40S) ribosomal subunit
; has similarity to rat riboso
mal protein S12

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00161060(coding)
ATGGCTGATCAAAACTAATAATTAAACGAAGTTTTAGCTAAGGTTATCAAGAGCTCTAAC
TGCCAAGATGCCATCTCCAAGGGTCTCCACGAAGTCTTGAGAACTATTGAAGCCAAGCAA
GCTCTTTTCGTTTGTGTTGCTGAAGATTGCGATTAAGGTAATTACGTCAAGTTAGTTAAG
GCTCTCTGCGCCAAGAACGAAATTAAGTATGTCTCTGTTCCCAAGAGAGCTAGTTTGGGT
GAATACTTGGGTCACTTCACCGCTAACGCTAAGGGTGAAATCAAGAAGGTTAAGGGTTGC
TCTTCTCTTGCCATTAGAAAGTACGCTCCCGAAATCACTGAAGATGAAAAGAAGATCATC
GAAGGTGCTCTTAAGGCTTGA


>TTHERM_00161060(protein)
MADQNQQLNEVLAKVIKSSNCQDAISKGLHEVLRTIEAKQALFVCVAEDCDQGNYVKLVK
ALCAKNEIKYVSVPKRASLGEYLGHFTANAKGEIKKVKGCSSLAIRKYAPEITEDEKKII
EGALKA


>TTHERM_00161060(gene)
ATGGCTGATCAAAACTAATAATTAAACGAAGTTTTAGCTAAGGTTATCAAGAGCTCTAAC
TGCCAAGATGCCATCTCCAAGGGTCTCCACGAAGTCTTGAGAACTATTGAAGCCAAGCAA
GCTCTTTTCGTTTGTGTTGCTGAAGATTGCGATTAAGGTAATTACGTCAAGTTAGTTAAG
GCTCTCTGCGCCAAGAACGAAATTAAGTATGTCTCTGTTCCCAAGAGAGCTAGTTTGGGT
GAATACTTGGGTCACTTCACCGCTAACGCTAAGGGTGAAATCAAGAAGGTTAAGGGTTGC
TCTTCTCTTGCCATTAGAAAGTACGCTCCCGAAATCACTGAAGATGAAAAGAAGATCATC
GAAGGTGCTCTTAAGGCTTGA