Identifiers and Description

Gene Model Identifier

TTHERM_00158390

Standard Name

None

Aliases

PreTt28429 | 13.m00388 | 3829.m01242

Description

Dpy-30 motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00158390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05295.18.001655364039598e-37dpy-30 domain-containing prote
in family protein (103 aa)
OxytrichaContig12107.0.g1110.00000000007999955850159168Dpy-30 motif
WormBaseWBGene000010880.00000000019994075865167896locus:dpy-30 Dosage compensa
tion protein dpy-30 status:C
onfirmed UniProt:Q10661 pr
otein_id:CAB01452.1
SGDYDR469W0.000019995566179747357SDC1 Subunit of the COMPASS (S
et1C) complex, which methylate
s lysine 4 of histone H3 and i
s required in chromatin silenc
ing at telomeres; contains a D
py-30 domain that mediates int
eraction with Bre2p; similar t
o C. elegans and human DPY-30

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00158390(coding)
ATGGCTGAGAAGAAAAAATAGCAATAATCGAAAGGATCATCTTAAGGATTACAAAATATT
GCTGATGAAGATGATGAATAGAATTAAAACCAAGATTAAGATGATGGATTGCTAACAGGA
GCTTCTAATTAGCAAGGAGGAGGTGGAAGTAAGTTTTAGCAACTTCCTTTAAGAGATTAT
TATGAGAGTTCTGTCACTTAAGTATTACTCGAAGGGTTAAGAGAGTTAGGTGCTAAGAGG
CCAGAAAATCCAATATAGTTTTTAGGAAAATTTTTATTAGACAGAGACCCAGAAAAGAAA
AAATGA


>TTHERM_00158390(protein)
MAEKKKQQQSKGSSQGLQNIADEDDEQNQNQDQDDGLLTGASNQQGGGGSKFQQLPLRDY
YESSVTQVLLEGLRELGAKRPENPIQFLGKFLLDRDPEKKK


>TTHERM_00158390(gene)
ATGGCTGGTAATAAATTGTATTTTAGCAAATTTAGAAAAAAATATTTATAAAATATCTAG
AGAAGAAAAAATAGCAATAATCGAAAGGATCATCTTAAGGATTACAAAATATTGCTGATG
AAGATGATGAATAGAATTAAAACCAAGATTAAGATGATGGATTGCTAACAGGAGCTTCTA
ATTAGCAAGGAGGAGGTGGAAGTAAGTTTTAGCAACTTCCTTTAAGAGATTATTATGAGA
GTTCTGTCACTTAAGTATTACTCGAAGGGTTAAGAGAGTTAGGTGCTAAGAGGTAAGATT
TAATCTTAATTCTGTTAAGACATAATTTACAAATAAAATAATTAATAGGCCAGAAAATCC
AATATAGTTTTTAGGAAAATTTTTATTAGACAGAGACCCAGAAAAGAAAAAATGA