Identifiers and Description

Gene Model Identifier

TTHERM_00152170

Standard Name

None

Aliases

PreTt20875 | 12.m00549 | 3700.m00268

Description

kinesin motor catalytic domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00152170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_332600
Tetrahymena borealisEI9_05167.19.997093137033517e-262kinesin motor domain-containin
g protein (632 aa)
OxytrichaContig12085.0.g329.997093137033517e-262Kinesin motor domain
WormBaseWBGene000022223.0002015969469427e-102locus:klp-11 status:Partiall
y_confirmed UniProt:Q19633
protein_id:CAA92295.2
DictyBaseDDB_G02809671.9995118794191673e-87kif3 on chromosome: 3 position
4109358 to 4113107
SGDYBL063W6.998611614275136e-73KIP1 Kinesin-related motor pro
tein required for mitotic spin
dle assembly, chromosome segre
gation, and 2 micron plasmid p
artitioning; functionally redu
ndant with Cin8p for chromosom
al but not plasmid functions

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00152170(coding)
ATGATTAATAACTTTCAAAAGGATTAGCTTAATACAAGTGGATTTTCTCACCAATCAAAT
ATGAATAATATGAGCATGAGCGGAGCTCCATCAAGCACAAACAAAGATAATTGCAAAGTA
GTTGTAAGAGTTCGTCCTCCTCTACCAAGAGAAATCGAAGATGGCCGCTTCATTTCTACA
ATTTAAGTTTCCCCCGACGGCAAAAAAATTTGTATTTATGAATACTACAATATAGAACTT
GTAGAACCAGAACAGCTATAAGACTATTTGAATAATGCAAATAATTATACTATGCATCAA
TTTTCATTTGACAATGTTTATGATTAAGACTCAACTCAAGAAGAAGTATACGAAAACACA
GCTAAATAATCAGTTATGAATGTACTTTAAGGGTTTAATGCTACTATTATGGCTTATGGT
TAAACAGGAACAGGTAAAACTTTCACAATGGAAGGGTTTAAGTATAACTCAATGGATCCT
CAAAGAGGTATTATTCCTCGTTCGATTGAAGAGATTTTCAAATATATCGAGAATTGCTCT
AACGAAAGCACTTAATTTATGGTCAGAGCAAGCTATCTGCAAATTTATAACGAAGTTATA
AGTGATTTAATTAGAACTGATCGCAACAATCTTTTAATCAGAGAAGATAAAAAAAGAGGT
GTATTTGTTGATGGATTATCAGAATGGGCAGTTAGAAATCCCACTGAAATATTCTCACTT
ATTTAACGTGGTGCTTAATTTAGAAGAACAGCTGCTACTAAGATGAATGATGTTTCATCT
CGTTCTCATGCTGTTTTTATAATCATTGTAGAATAAATGACATTTAATGGAGATGAAGCT
TCTCAAGCCTCCAAATAAATTAGAGTAGGAAAGCTAAATTTAGTTGATTTAGCAGGTAGC
GAAAGAGTAAGAGTCACAGGTGCTACTGGAAAGCGTTTAGAGGAATGCAAGAAAATTAAC
TAATCTCTTTCTTGTCTTGGTAATGTAATTTCTGCTTTGACAGACTCTAAATCCCCTAAA
TCCCATATTCCTTATAGAGATTCAAAGCTTACCAGATTATTAGAAGATTCGTTGGGTGGT
AACTGTAAGACTACTATGATGGCTATGATTTCACCAGCTCTAGAAGCATTCAGTGAGAGT
TTAAGTTCATTGAAATTTGCAAACAGAGCAAAAAATATTAAGAATTAACCTATTGTAAAT
GAGGACGTAGATCAAAGAGCTTTGTTGAGAAAATATGAAATAGAATTAAAAAAATTGAAA
TAAGAATTAGAAGAAAGAAATAAGATGCTTATTGATAAATCTCGTCTCATTCAACTAGAG
GAAGATAAGAAAAGGGCAGAGTTAGAAAAGAAAAACGCAATGGCTGCACTTGAAAAACGC
TCCAAAGAATTCTTTTAAGAAAGAGAAGAAAAGAAGAAACTTGAAGAAAAGATAAGAAGC
ATTAACACATAAATTCTAGTAGGTGGTTAAAAGATAGAAGATACTCCTCAATTTAGAAAT
GCATTGGAAGAATAGTAAAGAATAATCAGGTGCTAATATGAAAAACGCCTTTAAGACCTT
GAAAAAGAAAGAGAATAAATTACTGAAGATAAGGCTTAAGTTGACCGTTATAGATAGCTT
TTATTAAAATAAAGAGATATAATGATTGCTCTTACAACTAGATTAAATGAGAGAGATGAA
ACTATAATTCAGCTTTAGGAAGAGCTGGATGCATACGACCGTATTCATAGAGAAACAGAA
GAGTCTTTAGAATATCAAGTTTAGAGAAATTAATAACTGGAAAATCTCTTAATAGAAAAT
GATATTTAGTTCCCCAGAGATGACATTAGTAACTTTAAAAATGGCTAATATTAAAACCTT
GTATTAAATTAAAAAAAATCAGAAGAGCTATGA


>TTHERM_00152170(protein)
MINNFQKDQLNTSGFSHQSNMNNMSMSGAPSSTNKDNCKVVVRVRPPLPREIEDGRFIST
IQVSPDGKKICIYEYYNIELVEPEQLQDYLNNANNYTMHQFSFDNVYDQDSTQEEVYENT
AKQSVMNVLQGFNATIMAYGQTGTGKTFTMEGFKYNSMDPQRGIIPRSIEEIFKYIENCS
NESTQFMVRASYLQIYNEVISDLIRTDRNNLLIREDKKRGVFVDGLSEWAVRNPTEIFSL
IQRGAQFRRTAATKMNDVSSRSHAVFIIIVEQMTFNGDEASQASKQIRVGKLNLVDLAGS
ERVRVTGATGKRLEECKKINQSLSCLGNVISALTDSKSPKSHIPYRDSKLTRLLEDSLGG
NCKTTMMAMISPALEAFSESLSSLKFANRAKNIKNQPIVNEDVDQRALLRKYEIELKKLK
QELEERNKMLIDKSRLIQLEEDKKRAELEKKNAMAALEKRSKEFFQEREEKKKLEEKIRS
INTQILVGGQKIEDTPQFRNALEEQQRIIRCQYEKRLQDLEKEREQITEDKAQVDRYRQL
LLKQRDIMIALTTRLNERDETIIQLQEELDAYDRIHRETEESLEYQVQRNQQLENLLIEN
DIQFPRDDISNFKNGQYQNLVLNQKKSEEL


>TTHERM_00152170(gene)
ATGATTAATAACTTTCAAAAGGTAAAAAATTAGCATTCTTTGACAGTCCATTTAGATTAT
CTTAGATTAACCAAGAAAGCACAATAGTAATTTTTAATTTGTAATACTAAAAAAGGATTA
GCTTAATACAAGTGGATTTTCTCACCAATCAAATATGAATAATATGAGCATGAGCGGAGC
TCCATCAAGCACAAACAAAGATAATTGCAAAGTAGTTGTAAGAGTTCGTCCTCCTCTACC
AAGAGAAATCGAAGATGGCCGCTTCATTTCTACAGTAAATTAATTTGAAAGATAGTTCAC
TCACTTTTTAACTAACTAACTTATAGAAATCTCAATACAAAAATGAAATAAATTTTAAAT
ATAGATTTAAGTTTCCCCCGACGGCAAAAAAATTTGTATTTATGAATACTACAATATAGA
ACTTGTAGAACCAGAACAGCTATAAGACTATTTGAATAATGCAAATAATTATACTATGCA
TCAATTTTCATTTGACAATGTTTATGATTAAGACTCAACTCAAGAAGAAGTATACGAAAA
CACAGCTAAATAATCAGTTATGAATGTACTTTAAGGGTTTAATGCTACTATTATGGCTTA
TGGTTAAACAGGAACAGGTAAAACTTTCACAATGGAAGGGTTTAAGTATAACTCAATGGA
TCCTCAAAGAGGTATTATTCCTCGTTCGATTGAAGAGATTTTCAAATATATCGAGAATTG
CTCTAACGAAAGCGTAAAAACTAATACAATTTTTAAATAATTAAAATGAATTTGCTTTTC
AAAAAATATTTAATTTATTTATTTATTGATTTTAAATCGTTAAATTCAGATTGAGTAAAG
AATAATGATTTTTAAATTTTTAAATCAAACAAAAATTTTGTTTTCAATTTTTTTGTTTTT
AATTTAAAGACTTAATTTATGGTCAGAGCAAGCTATCTGCAAATTTATAACGAAGTTATA
AGTGATTTAATTAGAACTGATCGCAACAATCTTTTAATCAGAGAAGATAAAAAAAGAGGT
GTATTTGTTGATGGATTATCAGAATGGGCAGTTAGAAATCCCACTGAAATATTCTCACTT
ATTTAACGTGGTGCTTAATTTAGAAGAACAGCTGCTACTAAGATGAATGATGTTTCATCT
CGTTCTCATGCTGTTTTTATAATCATTGTAGAATAAATGACATTTAATGGAGATGAAGCT
TCTCAAGCCTCCAAATAAATTAGAGTAGGAAAGCTAAATTTAGTTGATTTAGCAGGTAGC
GAAAGAGTAAGAGTCACAGGTGCTACTGGAAAGCGTTTAGAGGAATGCAAGAAAATTAAC
TAATCTCTTTCTTGTCTTGGTAATGTAATTTCTGCTTTGACAGACTCTAAATCCCCTAAA
TCCCATATTCCTTATAGAGATTCAAAGGTAAATTAATTTATTGTTTATATTCTAATTAAA
ATTATTTATGCAAATAAATTTAGCTTACCAGATTATTAGAAGATTCGTTGGGTGGTAACT
GTAAGACTACTATGATGGCTATGATTTCACCAGCTCTAGAAGCATTCAGTGAGAGTTTAA
GTTCATTGAAATTTGCAAACAGAGCAAAAAATATTAAGAATTAACCTATTGTAAATGAGG
ACGTAGATCAAAGAGCTTTGTTGAGAAAATATGAAATAGAATTAAAAAAATTGAAATAAG
AATTAGAAGAAAGAAATAAGATGCTTATTGATAAATCTCGTCTCATTCAACTAGAGGAAG
ATAAGAAAAGGGCAGAGTTAGAAAAGAAAAACGCAATGGCTGCACTTGAAAAACGCTCCA
AAGAATTCTTTTAAGAAAGAGAAGAAAAGAAGAAACTTGAAGAAAAGATAAGAAGCATTA
ACACATAAATTCTAGTAGGTGGTTAAAAGATAGAAGATACTCCTCAATTTAGAAATGCAT
TGGAAGAATAGTAAAGAATAATCAGGTGCTAATATGAAAAACGCCTTTAAGACCTTGAAA
AAGAAAGAGAATAAATTACTGAAGATAAGGCTTAAGTTGACCGTTATAGATAGCTTTTAT
TAAAATAAAGAGATATAATGATTGCTCTTACAACTAGATTAAATGAGAGAGATGAAACTA
TAATTCAGCTTTAGGAAGAGCTGGATGCATACGACCGTATTCATAGAGAAACAGAAGAGT
CTTTAGAATATCAAGTTTAGAGAAATTAATAACTGGAAAATCTCTTAATAGAAAATGATA
TTTAGTTCCCCAGAGATGACATTAGTAACTTTAAAAATGGCTAATATTAAAACCTTGTAT
TAAATTAAAAAAAATCAGAAGAGCTATGA