Identifiers and Description

Gene Model Identifier

TTHERM_00151810

Standard Name

None

Aliases

PreTt20839 | PreTt20840 | 12.m00557 | 3700.m00233

Description

Elongation factor Tu, mitochondrial precursor, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR01393 ) GTP-binding protein LepA
  • ( PF03144 ) Elongation factor Tu domain 2
  • ( TIGR01394 ) GTP-binding protein TypA/BipA
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00485 ) translation elongation factor Tu
  • ( PF03143 ) elongation factor Tu C-terminal domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR02034 ) sulfate adenylyltransferase, large subunit
  • ( TIGR00483 ) translation elongation factor EF-1, subunit
  • ( TIGR00475 ) selenocysteine-specific translation elongation factor

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05135.19.99709313703352e-262elongation factor Tu (427 aa)
OxytrichaContig5181.0.g879.99709313703352e-262Elongation factor Tu GTP bindi
ng domain
SGDYOR187W4.00136676887777e-172TUF1 Mitochondrial translation
elongation factor Tu; compris
es both GTPase and guanine nuc
leotide exchange factor activi
ties, while these activities a
re found in separate proteins
in S. pombe and humans
DictyBaseDDB_G02895939.0011202525967e-151tufM on chromosome: 5 position
2977521 to 2978795
WormBaseWBGene000070003.00112600784692e-135locus:tufm-1 status:Confirme
d UniProt:G5ECM6 protein_i
d:CCD73874.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00151810(protein)
MFKNILKLGSNTQKTLSAIPCYGFAKFQRNKPHLNVGTIGHIDHGKTTLTAAITKICADK
KLAEFMAYDSIDKAPEEKARGITINTATVEYETETRHYGHVDCPGHIDYVKNMITGAAKM
DAGILVCSATDGVMPQTREHILLCRQVGVKTIIVFVNKCDMAKDPEIQELVEMEVRELLS
KYEYNGDEAPVIFGSALCALNGTDPEIGINKINTLLDTMDKQIALPERTVDKPFMMSVEG
TYQIPGRGTVVTGTVDTGKVKTGEDIEIVGYSNKVLKTTITGIETFRKQLDYAEAGDNVG
LLLRGVTRDDVRRGQVLSKPGTQESHKKIEANLYILTEQEGGRKKPFPDGYRPQLYLRTA
DVAAQISIHGANKLGMPGDNITANLDLHFPLPVAPGKLTIILFNNQCQQQNNFQIKGLRF
ALREGGKTIAAGVISKVIPEEKEAPKK


>TTHERM_00151810(coding)
ATGTTTAAGAATATCTTAAAGTTAGGTTCCAACACCTAAAAAACTTTATCTGCTATTCCT
TGTTATGGTTTCGCTAAGTTCCAAAGAAATAAACCTCACTTGAATGTCGGTACCATTGGT
CATATTGATCACGGTAAGACCACTCTTACTGCTGCCATCACTAAGATTTGTGCTGATAAG
AAGTTAGCTGAATTCATGGCTTACGATTCTATCGATAAGGCTCCTGAAGAAAAGGCCAGA
GGTATTACCATTAACACTGCTACCGTAGAATACGAAACTGAAACCCGTCACTACGGTCAC
GTTGATTGCCCTGGTCACATCGATTACGTTAAGAATATGATTACTGGTGCCGCTAAGATG
GATGCTGGTATTTTAGTTTGCTCTGCCACTGATGGTGTCATGCCTTAAACCAGAGAACAT
ATTTTATTATGCAGATAAGTCGGTGTCAAGACTATTATCGTTTTCGTCAATAAGTGTGAT
ATGGCTAAGGATCCTGAAATCTAAGAATTGGTTGAAATGGAAGTTAGAGAATTGCTTTCT
AAATACGAATACAATGGTGATGAAGCTCCAGTTATCTTTGGTTCCGCCCTTTGCGCCCTC
AACGGTACTGATCCCGAAATTGGTATCAATAAGATTAATACTTTATTAGACACCATGGAT
AAATAAATTGCTTTACCCGAAAGAACTGTTGATAAGCCTTTCATGATGTCAGTCGAAGGT
ACCTATTAAATTCCCGGTAGAGGTACTGTCGTTACTGGTACCGTCGATACTGGTAAGGTT
AAGACTGGTGAAGATATCGAAATTGTTGGTTACTCTAATAAGGTCCTTAAGACCACAATT
ACCGGTATTGAAACCTTCAGAAAGCAACTTGACTACGCTGAAGCTGGTGACAACGTTGGT
CTCCTTCTTAGAGGTGTTACTAGAGATGATGTCAGAAGAGGTTAAGTTTTAAGTAAACCT
GGTACTTAAGAATCCCATAAAAAGATTGAAGCTAACTTATATATCTTGACCGAATAAGAA
GGTGGTCGTAAGAAGCCTTTCCCCGATGGTTACAGACCTTAACTCTATTTGAGAACTGCT
GATGTTGCTGCTCAAATCTCTATTCACGGTGCTAATAAATTAGGTATGCCTGGTGATAAT
ATTACTGCTAACCTCGATCTTCACTTCCCTCTCCCTGTTGCTCCAGGTAAATTAACTATC
ATTTTGTTTAATAATTAATGTTAATAATAAAATAATTTTTAAATTAAAGGTTTGAGATTC
GCTCTTAGAGAAGGTGGTAAGACTATTGCTGCCGGTGTTATTTCTAAGGTTATCCCTGAA
GAAAAGGAAGCTCCCAAGAAATGA


>TTHERM_00151810(gene)
ATGTTTAAGAATATCTTAAAGTTAGGTTCCAACACCTAAAAAACTTTATCTGCTATTCCT
TGTTATGGTTTCGCTAAGTTCCAAAGAAATAAACCTCACTTGAATGTCGGTACCATTGGT
CATATTGATCACGGTAAGACCACTCTTACTGCTGCCATCACTAAGATTTGTGCTGATAAG
AAGTTAGCTGAATTCATGGCTTACGATTCTATCGATAAGGCTCCTGAAGAAAAGGCCAGA
GGTATTACCATTAACACTGCTACCGTAGAATACGAAACTGAAACCCGTCACTACGGTCAC
GTTGATTGCCCTGGTCACATCGATTACGTTAAGAATATGATTACTGGTAAATTTTAATAT
TTTTTTCTTCTCCTATTTTTTGATATATTTTAACTAGTTCTCTCTATGATTGTGAGTTAA
GAATAATAAAATAAAGAAAATCTTAGAAAGAGGAAATATCATTTCTTCGAATCTTCTGTT
TTTTTCTTAAACCATCAATCTAATCACAATTTTAAAATTAATAAAATAAAATTATAAAAT
TTTTTATAACACTCATAATCTAGCTATTCAGTTCAATATAATAAATATAACAATATTCTA
TTATAAGCCTGTATAGTTTAGCATAATAGCTCTTATCTATTTACAAAATCAATAGTTTTT
TCTATCTTCTTGAGATATGTTATGATTTAACTCTCCAACAAAAGAATTCTAAACAAGAGC
AAGAAATGCATTAGATTGATGGATTATAAGATAAATAAAATAAAGTATAGATAATATATG
AATTTAAAATAGAAATTTCATGAAGCATTTTGAATAAATTTTGACAATCTCTAGGAGAAT
TTATAAATATTTCAAATAATTAGAACAACATTATTAAAATAAAATCATTTATTGAAAAAA
AGGTGCCGCTAAGATGGATGCTGGTATTTTAGTTTGCTCTGCCACTGATGGTGTCATGCC
TTAAACCAGAGAACATATTTTATTATGCAGATAAGTCGGTGTCAAGACTATTATCGTTTT
CGTCAATAAGTGTGATATGGCTAAGGATCCTGAAATCTAAGAATTGGTTGAAATGGAAGT
TAGAGAATTGCTTTCTAAATACGAATACAATGGTGATGAAGCTCCAGTTATCTTTGGTTC
CGCCCTTTGCGCCCTCAACGGTACTGATCCCGAAATTGGTATCAATAAGGTAATAAATAA
AAAAGCTTTCGAATTAAATCAATAAGAAATCTATAATGATTGTTTTTTAATACTGATGTT
ATTATCTATAAAAATAAAGAATTGAAAGTATTAAAGATTTTTCTATTTTCAATTCACTTA
AAAAAGGATTAACATAGTAGAACTTAAATATATTTTTAGCAACAATAAATAATTAATTGT
GTAGAATTAAATATTCAACATAAATAAATAAAAAAGATTATAAAATATAATCAACCACTT
TGGTAAAAAACTCATACTGAAAGGCGTCTTGCAAGATTGGATTGAGTAAACTAAAAGTGG
AAAATCAATTCCTACCAAAACCTTAAGATTTTATCAATTAGAAAGATGGAAAAAGAACTT
ACGTTCTGAATAAAATGCGTTAGAGATGTAGATTTGAGTAATTGAAAAATTATTCATGTC
TATTAATTTCTAGCGTACACCAAAATTTTATGCCATCGATCGAGGGCGTTATCATGCACC
TTACATTTGATGAAATTGAGCATACGGAAGGAAACATTCAAATTAAAATTATTACATACC
ATAAAAATAAATGATATTGCAATTATCATTAACAATAATAAATTTTAACTTATTTTAAAT
AAATAAAACAGATTAATACTTTATTAGACACCATGGATAAATAAATTGCTTTACCCGAAA
GAACTGTTGATAAGCCTTTCATGATGTCAGTCGAAGGTACCTATTAAATTCCCGGTAGAG
GTACTGTCGTTACTGGTACCGTCGATACTGGTAAGGTTAAGACTGGTGAAGATATCGAAA
TTGTTGGTTACTCTAATAAGGTCCTTAAGACCACAATTACCGGTATTGAAACCTTCAGAA
AGCAACTTGACTACGCTGAAGCTGGTGACAACGTTGGTCTCCTTCTTAGAGGTGTTACTA
GAGATGATGTCAGAAGAGGTATTAAATTATTAATAAAGTAGTTAACTTATTATTAATCTT
ATTAATATTAAAAATAGGTTAAGTTTTAAGTAAACCTGGTACTTAAGAATCCCATAAAAA
GATTGAAGCTAACTTATATATCTTGACCGAATAAGAAGGTGGTCGTAAGAAGCCTTTCCC
CGATGGTTACAGACCTTAACTCTATTTGAGAACTGCTGATGTTGCTGCTCAAATCTCTAT
TCACGGTGCTAATAAATTAGGTATGCCTGGTGATAATATTACTGCTAACCTCGATCTTCA
CTTCCCTCTCCCTGTTGCTCCAGGTAAATTAACTATCATTTTGTTTAATAATTAATGTTA
ATAATAAAATAATTTTTAAATTAAAGGTTTGAGATTCGCTCTTAGAGAAGGTGGTAAGAC
TATTGCTGCCGGTGTTATTTCTAAGGTTATCCCTGAAGAAAAGGAAGCTCCCAAGAAATG
A