Identifiers and Description

Gene Model Identifier

TTHERM_00151810

Standard Name

None

Aliases

PreTt20839 | PreTt20840 | 12.m00557 | 3700.m00233

Description

Elongation factor Tu, mitochondrial precursor, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR01393 ) GTP-binding protein LepA
  • ( PF03144 ) Elongation factor Tu domain 2
  • ( TIGR01394 ) GTP-binding protein TypA/BipA
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00485 ) translation elongation factor Tu
  • ( PF03143 ) elongation factor Tu C-terminal domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR02034 ) sulfate adenylyltransferase, large subunit
  • ( TIGR00483 ) translation elongation factor EF-1, subunit
  • ( TIGR00475 ) selenocysteine-specific translation elongation factor

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05135.19.99709313703352e-262elongation factor Tu (427 aa)
OxytrichaContig5181.0.g871.99961617776172e-164Elongation factor Tu GTP bindi
ng domain
ParameciumDBGSPATP000264000019.99626136195951e-120Paramecium tetraurelia GSPATP0
0026400001 protein
SGDYOR187W9.9950941977843e-101TUF1 SGDID:S000005713, Chr XV
from 684031-685344, Verified O
RF, "Mitochondrial translation
elongation factor Tu; compris
es both GTPase and guanine nuc
leotide exchange factor activi
ties, while these activities a
re found in separate proteins
in S. pombe and humans"
ToxoDB55.m001752.99918058617197e-98Toxoplasma gondii elongation f
actor Tu, putative
PlasmoDBMAL13P1.1647.99781938323555e-96Plasmodium falciparum 164
TAIRAT4G029308.99796770642765e-94elongation factor Tu, putative
/ EF-Tu, putative
IPI(HUMAN)IPI:IPI00027107.43.99813721121173e-92 PROT:P49411|ENSEMBL:ENSP00000
322439|REFSEQ:NP_003312|H- INV
:HIT000030534;HIT000034759|VEG
A:OTTHUMP00000081636 Tax_Id=96
06 Elongation factor Tu, mitoc
hondrial precursor
FlyBaseFBgn00245561.00007327915485e-89
DictyBaseDDB02194641.00048830265696e-88BC5V2_0_01173 Elongation facto
r Tu (EC 3.6.1.48).
WormBaseY71H2AM.233.00109621076182e-82WBGene00007000 tufm-1
CryptoDBEAK892302.00023732685282e-09Cryptosporidium parvum (Iowa)
protein EAK89230

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00151810(protein)
MFKNILKLGSNTQKTLSAIPCYGFAKFQRNKPHLNVGTIGHIDHGKTTLTAAITKICADK
KLAEFMAYDSIDKAPEEKARGITINTATVEYETETRHYGHVDCPGHIDYVKNMITGAAKM
DAGILVCSATDGVMPQTREHILLCRQVGVKTIIVFVNKCDMAKDPEIQELVEMEVRELLS
KYEYNGDEAPVIFGSALCALNGTDPEIGINKINTLLDTMDKQIALPERTVDKPFMMSVEG
TYQIPGRGTVVTGTVDTGKVKTGQVLSKPGTQESHKKIEANLYILTEQEGGRKKPFPDGY
RPQLYLRTADVAAQISIHGANKLGMPGDNITANLDLHFPLPVAPGLRFALREGGKTIAAG
VISKVIPEEKEAPKK


>TTHERM_00151810(coding)
ATGTTTAAGAATATCTTAAAGTTAGGTTCCAACACCTAAAAAACTTTATCTGCTATTCCT
TGTTATGGTTTCGCTAAGTTCCAAAGAAATAAACCTCACTTGAATGTCGGTACCATTGGT
CATATTGATCACGGTAAGACCACTCTTACTGCTGCCATCACTAAGATTTGTGCTGATAAG
AAGTTAGCTGAATTCATGGCTTACGATTCTATCGATAAGGCTCCTGAAGAAAAGGCCAGA
GGTATTACCATTAACACTGCTACCGTAGAATACGAAACTGAAACCCGTCACTACGGTCAC
GTTGATTGCCCTGGTCACATCGATTACGTTAAGAATATGATTACTGGTGCCGCTAAGATG
GATGCTGGTATTTTAGTTTGCTCTGCCACTGATGGTGTCATGCCTTAAACCAGAGAACAT
ATTTTATTATGCAGATAAGTCGGTGTCAAGACTATTATCGTTTTCGTCAATAAGTGTGAT
ATGGCTAAGGATCCTGAAATCTAAGAATTGGTTGAAATGGAAGTTAGAGAATTGCTTTCT
AAATACGAATACAATGGTGATGAAGCTCCAGTTATCTTTGGTTCCGCCCTTTGCGCCCTC
AACGGTACTGATCCCGAAATTGGTATCAATAAGATTAATACTTTATTAGACACCATGGAT
AAATAAATTGCTTTACCCGAAAGAACTGTTGATAAGCCTTTCATGATGTCAGTCGAAGGT
ACCTATTAAATTCCCGGTAGAGGTACTGTCGTTACTGGTACCGTCGATACTGGTAAGGTT
AAGACTGGTTAAGTTTTAAGTAAACCTGGTACTTAAGAATCCCATAAAAAGATTGAAGCT
AACTTATATATCTTGACCGAATAAGAAGGTGGTCGTAAGAAGCCTTTCCCCGATGGTTAC
AGACCTTAACTCTATTTGAGAACTGCTGATGTTGCTGCTCAAATCTCTATTCACGGTGCT
AATAAATTAGGTATGCCTGGTGATAATATTACTGCTAACCTCGATCTTCACTTCCCTCTC
CCTGTTGCTCCAGGTTTGAGATTCGCTCTTAGAGAAGGTGGTAAGACTATTGCTGCCGGT
GTTATTTCTAAGGTTATCCCTGAAGAAAAGGAAGCTCCCAAGAAATGA


>TTHERM_00151810(gene)
TAAAAATATAATAAATACAAGTCATACTATTAATTATAAATAAAGCACAAATGTTTAAGA
ATATCTTAAAGTTAGGTTCCAACACCTAAAAAACTTTATCTGCTATTCCTTGTTATGGTT
TCGCTAAGTTCCAAAGAAATAAACCTCACTTGAATGTCGGTACCATTGGTCATATTGATC
ACGGTAAGACCACTCTTACTGCTGCCATCACTAAGATTTGTGCTGATAAGAAGTTAGCTG
AATTCATGGCTTACGATTCTATCGATAAGGCTCCTGAAGAAAAGGCCAGAGGTATTACCA
TTAACACTGCTACCGTAGAATACGAAACTGAAACCCGTCACTACGGTCACGTTGATTGCC
CTGGTCACATCGATTACGTTAAGAATATGATTACTGGTAAATTTTAATATTTTTTTCTTC
TCCTATTTTTTGATATATTTTAACTAGTTCTCTCTATGATTGTGAGTTAAGAATAATAAA
ATAAAGAAAATCTTAGAAAGAGGAAATATCATTTCTTCGAATCTTCTGTTTTTTTCTTAA
ACCATCAATCTAATCACAATTTTAAAATTAATAAAATAAAATTATAAAATTTTTTATAAC
ACTCATAATCTAGCTATTCAGTTCAATATAATAAATATAACAATATTCTATTATAAGCCT
GTATAGTTTAGCATAATAGCTCTTATCTATTTACAAAATCAATAGTTTTTTCTATCTTCT
TGAGATATGTTATGATTTAACTCTCCAACAAAAGAATTCTAAACAAGAGCAAGAAATGCA
TTAGATTGATGGATTATAAGATAAATAAAATAAAGTATAGATAATATATGAATTTAAAAT
AGAAATTTCATGAAGCATTTTGAATAAATTTTGACAATCTCTAGGAGAATTTATAAATAT
TTCAAATAATTAGAACAACATTATTAAAATAAAATCATTTATTGAAAAAAAGGTGCCGCT
AAGATGGATGCTGGTATTTTAGTTTGCTCTGCCACTGATGGTGTCATGCCTTAAACCAGA
GAACATATTTTATTATGCAGATAAGTCGGTGTCAAGACTATTATCGTTTTCGTCAATAAG
TGTGATATGGCTAAGGATCCTGAAATCTAAGAATTGGTTGAAATGGAAGTTAGAGAATTG
CTTTCTAAATACGAATACAATGGTGATGAAGCTCCAGTTATCTTTGGTTCCGCCCTTTGC
GCCCTCAACGGTACTGATCCCGAAATTGGTATCAATAAGGTAATAAATAAAAAAGCTTTC
GAATTAAATCAATAAGAAATCTATAATGATTGTTTTTTAATACTGATGTTATTATCTATA
AAAATAAAGAATTGAAAGTATTAAAGATTTTTCTATTTTCAATTCACTTAAAAAAGGATT
AACATAGTAGAACTTAAATATATTTTTAGCAACAATAAATAATTAATTGTGTAGAATTAA
ATATTCAACATAAATAAATAAAAAAGATTATAAAATATAATCAACCACTTTGGTAAAAAA
CTCATACTGAAAGGCGTCTTGCAAGATTGGATTGAGTAAACTAAAAGTGGAAAATCAATT
CCTACCAAAACCTTAAGATTTTATCAATTAGAAAGATGGAAAAAGAACTTACGTTCTGAA
TAAAATGCGTTAGAGATGTAGATTTGAGTAATTGAAAAATTATTCATGTCTATTAATTTC
TAGCGTACACCAAAATTTTATGCCATCGATCGAGGGCGTTATCATGCACCTTACATTTGA
TGAAATTGAGCATACGGAAGGAAACATTCAAATTAAAATTATTACATACCATAAAAATAA
ATGATATTGCAATTATCATTAACAATAATAAATTTTAACTTATTTTAAATAAATAAAACA
GATTAATACTTTATTAGACACCATGGATAAATAAATTGCTTTACCCGAAAGAACTGTTGA
TAAGCCTTTCATGATGTCAGTCGAAGGTACCTATTAAATTCCCGGTAGAGGTACTGTCGT
TACTGGTACCGTCGATACTGGTAAGGTTAAGACTGGTGAAGATATCGAAATTGTTGGTTA
CTCTAATAAGGTCCTTAAGACCACAATTACCGGTATTGAAACCTTCAGAAAGCAACTTGA
CTACGCTGAAGCTGGTGACAACGTTGGTCTCCTTCTTAGAGGTGTTACTAGAGATGATGT
CAGAAGAGGTATTAAATTATTAATAAAGTAGTTAACTTATTATTAATCTTATTAATATTA
AAAATAGGTTAAGTTTTAAGTAAACCTGGTACTTAAGAATCCCATAAAAAGATTGAAGCT
AACTTATATATCTTGACCGAATAAGAAGGTGGTCGTAAGAAGCCTTTCCCCGATGGTTAC
AGACCTTAACTCTATTTGAGAACTGCTGATGTTGCTGCTCAAATCTCTATTCACGGTGCT
AATAAATTAGGTATGCCTGGTGATAATATTACTGCTAACCTCGATCTTCACTTCCCTCTC
CCTGTTGCTCCAGGTAAATTAACTATCATTTTGTTTAATAATTAATGTTAATAATAAAAT
AATTTTTAAATTAAAGGTTTGAGATTCGCTCTTAGAGAAGGTGGTAAGACTATTGCTGCC
GGTGTTATTTCTAAGGTTATCCCTGAAGAAAAGGAAGCTCCCAAGAAATGA