Identifiers and Description

Gene Model Identifier

TTHERM_00151270

Standard Name

None

Aliases

PreTt20788 | 12.m00462 | 3700.m00182

Description

Mitochondrial carrier protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein
  • ( TIGR00756 ) pentatricopeptide repeat domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.2%

TetraMine Data

TTHERM_00151270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05087.19.997093137033517e-262mitochondrial carrier protein
(300 aa)
OxytrichaContig6862.0.g212.9991172563576427e-86Mitochondrial carrier protein
DictyBaseDDB_G02833334.000989088096131e-71ucpB on chromosome: 4 position
469001 to 470093
SGDYKL120W4.001118334825066e-42OAC1 Mitochondrial inner membr
ane transporter, transports ox
aloacetate, sulfate, thiosulfa
te, and isopropylmalate; membe
r of the mitochondrial carrier
family
WormBaseWBGene000151868.001058982644703e-42locus:misc-1 status:Confirme
d UniProt:P90992 protein_i
d:CCD61938.1
Stentor CoeruleusSteCoe_296671.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00151270(coding)
ATGGAAACAGTAAAAGGAAGTTCAATTTAAGAATCTGCTATAAGAATGGCTTTAGCAGGA
GTAGCTTCAATGATATCAGGTTTTGTTACTCATCCTATTGATACAGTTAAAATTAGATTG
TAAAAAGAAGGAGAAGTTGTAGCAGGAGTTCCAAAATAAAAAAAATACTATAATATAGTT
ACAGGCATGAAAGTAATTGTTTAAGAAGAGGGCTTTTTCTCTCTTTACAAGGGTCTCTAA
GCTAGTTTACTGAGAGAAGCAACTTATTCTACTTTGAGACTTGGTCTCTATGAACCCTTT
AAAGAAATGCTTGGTGCCACAGATCCCAAAAACACTCCAGTTTGGAAAAAATTTATGGCT
GGATTATTAAGTGGATCAGCAGGAGCATTAGTCTCTAATCCCTTAGATTTAATTAAAGTT
AGATTATAAAATGTTGAAGGACGCGCTAAAAAAGGATTTATTTAAGAAATTTCAAAAATT
ATTGAAGCTTAAGGAGTTTAGGGATTGTGGAGAGGATTAATGCCTAATCTAACAAGAGGA
GCAATTCTTACTGGTACCAAAATGACCACATATGACCATACTAAGCATATGATATAAAAA
TATTTGAATATAAAAGAAGGATTCTCTGTTTATTTGATATGTTCTTTTGTTACAGGTTTT
GTCCTTTCAGTTACTACTTCTCCAATGGATGTGATTAAAACAAGAATTATGAGTTAAAAA
ATGGGAGCAAAGACATATAATGGACTTATTGATTGTGCTGTAAAGACATATTAATTTGAA
GGTGTAAAAGGATTTTATAAAGGTTTTATTCCTTAGTGGTGCCGCTTCGGACCTATGAAC
GTAATTTAACTTATATCATGGGAGTATCTTCGTAAATTATTTGGCATTAAGACCCTTTGA


>TTHERM_00151270(protein)
METVKGSSIQESAIRMALAGVASMISGFVTHPIDTVKIRLQKEGEVVAGVPKQKKYYNIV
TGMKVIVQEEGFFSLYKGLQASLLREATYSTLRLGLYEPFKEMLGATDPKNTPVWKKFMA
GLLSGSAGALVSNPLDLIKVRLQNVEGRAKKGFIQEISKIIEAQGVQGLWRGLMPNLTRG
AILTGTKMTTYDHTKHMIQKYLNIKEGFSVYLICSFVTGFVLSVTTSPMDVIKTRIMSQK
MGAKTYNGLIDCAVKTYQFEGVKGFYKGFIPQWCRFGPMNVIQLISWEYLRKLFGIKTL


>TTHERM_00151270(gene)
ATGGAAACAGTAAAAGGAAGTTCAATTTAAGAATCTGCTATAAGAATGGCTTTAGCAGGA
GTAGCTTCAATGATATCAGGTTTTGTTACTCATCCTATTGATACAGTTAAAATTAGATTG
TAAAAAGAAGGAGAAGTTGTAGCAGGAGTTCCAAAATAAAAAAAATACTATAATATAGTT
ACAGGCATGAAAGTAATTGTTTAAGAAGAGGGCTTTTTCTCTCTTTACAAGGGTCTCTAA
GCTAGTTTACTGAGAGAAGCAACTTATTCTACTTTGAGACTTGGTCTCTATGAACCCTTT
AAAGAAATGCTTGGTGCCACAGATCCCAAAAACACTCCAGTTTGGAAAAAATTTATGGCT
GGATTATTAAGTGGATCAGCAGGAGCATTAGTCTCTAATCCCTTAGATTTGTAATATTAA
TTCCCGTTTAAAATTTAAAATAAACAATATCAATTATAAAAGAATTAAAGTTAGATTATA
AAATGTTGAAGGACGCGCTAAAAAAGGATTTATTTAAGAAATTTCAAAAATTATTGAAGC
TTAAGGAGTTTAGGGATTGTGGAGAGGATTAATGCCTAATCTAACAAGAGGAGCAATTCT
TACTGGTACCAAAATGACCACATATGACCATACTAAGCATATGATATAAAAATATTTGAA
TATAAAAGAAGGATTCTCTGTTTATTTGATATGTTCTTTTGTTACAGGTTTTGTCCTTTC
AGTTACTACTTCTCCAATGGATGTGATTAAAACAAGAATTATGAGTTAAAAAATGGGAGC
AAAGACATATAATGGACTTATTGATTGTGCTGTAAAGACATATTAATTTGAAGGTGTAAA
AGGATTTTATAAAGGTTTTATTCCTTAGTGGTGCCGCTTCGGACCTATGAACGTAATTTA
ACTTATATCATGGGAGTATCTTCGTAAATTATTTGGCATTAAGACCCTTTGA