Identifiers and Description

Gene Model Identifier

TTHERM_00150000

Standard Name

MSH6L3 (MutS Homolog 6 (MSH6)-like protein 3)

Aliases

PreTt20760 | 12.m00434 | 3700.m00155

Description

DNA mismatch repair MutS family DNA-binding domain protein; MutS domain III family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00150000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05062.19.997093137033517e-262MutS domain III family protein
(1389 aa)
OxytrichaContig820.1.g1221.999489510516749e-128MutS domain V
DictyBaseDDB_G02686141.0003926095686843e-81msh6 on chromosome: 1 position
238722 to 242663
SGDYDR097C1.0000310450948521e-65MSH6 Protein required for mism
atch repair in mitosis and mei
osis, forms a complex with Msh
2p to repair both single-base
& insertion-deletion mispairs;
potentially phosphorylated by
Cdc28p
WormBaseWBGene000034221.9990871925214856e-61locus:msh-6 status:Partially
_confirmed UniProt:Q9N3T8
protein_id:CCD72556.1
Stentor CoeruleusSteCoe_175853.392270193026015e-47

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00150000(coding)
ATGCCTCCTAAAAAGACTAAATCAAGCGAAGTAAAAGAAAGCAGATCTTCTTCTAAGAAA
AATGTTATTGATTCTGAAGACAGTGAAGATCAAGCTATTAAGAAAACACCTAATACTAAA
AAAGGATCAAATGCTGCAAATGCAAAAAGTGTTTTATCAAAAGAAAGCTCAGTTTAAAAA
AGCAACTCATCAGATAATAAAAGAGCTTTAAAAAAAATCTAATTAAGTGAATCTGAGGGA
GAAGATAAAGAGCTTTTTCCCACAGCACCTGCGAAAAAGAAATCTGCTCCTGCTCCCAAA
GAAATTATAGTTAAGGAAGAAGAAAGTAGCGAAGATGATTAAGTTGTGAAAATTAAAAAT
AATAAAAATGGATCAGCTGCTGCTGCTACAACAACAAATAAAGTTGCTAAAAATAAAAAG
AAAATTAGTGATAATGAATCTTGTGATGAAGAAGAAGAATAAATGACTAAAAATAAAAAA
GCAACAAATTAAGCTAAAAATAAAAAAACTGACAAAGAAAATGAAACTAAGTAGACTACC
TAACGCTCGTCAAGAAATTAGAAAAAGATTTCTTACAAAGAAGAAGATGAAGAAGACGAA
TACACTCCTGAATAAGAAGATGAAGATTTTAAGGATGAAGAAGTTGATGAAGTTGAAGAG
GATGAAGAAGAAGGAGATGAGCTTAACTCAGATGATGATTTTGAAGAATAAGGCAAAAAG
AATAAAAAGAATGGATAAAGAAAAAATAATAAAAAAGCAAATGGAAGAAGTGAAGGCGCA
AATAATGAAAAAGCTGCTAAAAAAATTCATAAGGCTCCAGAAAATGCTGATGACAATCAC
ATAATAGATGTATAAAAAGAATAAGGAAAATTGGATATAGAAGATTAATATGAATTGCCA
TACTTTTTAACAAAGAAGTATTTAAAAGATGCAGAAGGTAGACCAGTAGACGATCCTGAG
TACGATCCATCAACTCTGTTTATCCCTATATAAGAGTTAAAAAAGGAAACACCTCTTTTC
TAATAATATTGGAAAATTAAAGTAAAGCATTTTGACAAGGTAGTGTTTTTTAGATTTGGA
AGAAATTTTGTTTGCTTTTATACTGATGCCATTCTGATGAAAAAGCTCTTCGATTGCTAT
ATTGGAGTCTGGGGCAAAAGACCTGTTGCTAATATTTTCGATAATCACTATCGTTTTTAT
GTAAAAGAACTTCTCGAAAAAGCAGATAAGTCTTGTTTAGTTGTAGATTAAGTTCAATTT
TCAGATGATAGATCAAATGAATAATATCTTATTAAAAGAGAAGTTACCTAGATTATAACT
AAGGGTACTTATACTGATTATGTAGATAATGTCGAAGATTATAATGCAAGATATTTAATG
TGTATAGTAGAGAGTGAAACTGATCATTCATTTGGTTTAGTTCTTATAGATTGTACAACC
CATCAAATATATTTAGATGATATCAAAAATGACCCAGCAGGAAACCAAATTCGTACAATT
TTAAGAAAAATGAAACCTGTTGAAATTCACTCAGTCTTTAATAATCTTTCTGAATAAACT
AAAAATATTTGCAAAACAACATGCAAACCATAATTTACATTTGATAAATCGTTTGAATTT
TATGAGCTTTAAAGTATTTTCGAAGAGCTTAAAAATGAGTTTAGAGAGAAAATTCCAATT
AATAATCCCGATAGTATGAAGAAAAGTAATTAAATGGAGATAGAAAAACCCAAGGCCAAC
AAGAAAAACAATAAAAAAAATAATAAAAAGAAATAAAGTGATGATGATGAAGATGGATCA
GATGAAAGCTCTGATGAAGAAAAATCAAAAAGCTTAGTAGATGAAGAAGATGATGACGGA
AGTGACAGTGAAGATGATATTGAAAACCTGTACAAGCCTGAAGTTAAAAAAGAGCCTAAA
TTTACTTACGGTGAACTTAGCAGCGATTATCCTTTACTATTGAAAGATATAGAGGAAATG
TACAACATAGATAAAAAAAAATTTGAGGAAGAACTCTAAAAAAAAGCTAATAGGAAGCAA
AAAAATTCTCAAGATATGTAAAATGAAGAAGATGATGATGAACCTTGCTTCGACATAGAA
TACCAGTATTATATGATGCTTTAAGCATTAATGCTTGGACTAAGCTACTTGAGAAAGCTG
AAATTGAATGATAATGTATTTAGACTTGGTTCCTTTTCTCTTTTAGATTCAACTGTTTAA
AAGAATACTTTTCTCCATTTAGATGCTCATGCAATAGAAAATTTAGATATTTTCGAGGTC
AATTTATAAAACCGTGTTACTTCTGAAGGGTCTTTGATGTCTTTTATTGATTACACTAAA
ACTCAATTCGGAAAAAGAATGCTTAAGAGATGGCTATCTTATCCACTAAAAAGTATATAG
CAAATAGAATAAAGGTAAGAAGCCATAGAAGATTTAATGAAAATAGAGGATGTAATTGAG
TAATTTGATAAGAAACTCAGTAAATTAGGAGATGTCGAAAGATAAATTAGCAAAATTTTT
AACTCATCTTAGAAATCAAGACTTAAACCTACTTCTTTTGAAAACTTCTCAAATGTCAGA
TTAAAAGATGCTTATTCTTTAGTTGAGGATTTAAAAAATTTAGAAGAAATTTTACTTATT
TTCAAAGATTATTAAGACAATTTTAATTCAACTAAACTCAAAAAATTGGTTACTGTAAAG
GATCCTGAATAAATTAATAAAATTTTAGAGAGTACCAGATAAAAAAATAACTCGTAAACC
TATCTTTCATAAAAATTACTTAATAGGTAAAGCAGCACAAATAGTAAATCTAAGCAGTAA
ATTATAGTTGGTATTTTCCCAGACTTAAAGCCTTTTGTAGAGTTGATATAGAGTTAGCTC
GAATAGGATGAATAAGGTTACTGCCAACCTAAATAAGGAGCAGATGCAGTTTATGATGAA
ATTGTATTTAAAATGAAAAAAATTTATAAGAAGATGAATAATGAAGCACTTGTCTGGCGT
AAAAAATTTAACAATAACTAAGATATAAAATTAATAAAAAGCAAAATGTAATGGGAAATA
TAAATACCTGAGAAGCTTGTTGAAGGATCAAAGAAACCTAAAGAACTTTATCTCACTTCT
AAAGTTAAAGGTTATCAAAGATTCTAAACAGATAAAATAATTAGTCTATGTGCAAAACTT
AAAAAAGTAGAAGTCTAATTGCAAAAAGCCCTCTCTCCTTTTTGTGAAAGATTTTTCCAT
TTGTTTTATTAAAATAGAGAACTATTGTATTAGGCTGTTAATTGCATTGGTGAGTTAGAT
TGCTTATGCTCTTTGGCTAAGTGTTCTCTTAATCTTAAGATAAGATGCAAACCAACTTTT
ATTCCAGAAAGTTTAAATAAAAATGTTTTCGAACTTATAGAAATGTATCACCCCTAACTG
CTAAAGGAAAATAAAAAAAATTTAGTACCAAATGATACAATTTTCGAAGATAATGTTACT
TGTATGCTTGTCACAGGTCCAAATATGGGTGGTAAATCAACACTTCTTAGATAAAATTGC
TTAGCTGTTATTCTAGCACAATTAGGTTGCTTCTTGCCTGCTAAAAGTTTTAAAACAATT
ATAAGAGACAGAATTTTCTGTAGAATAGGTGCTTCTGATAGATTACTAGAAGGAAAATCA
ACCTTTTTGGTAGAAATGGAAGAGACAGGAGATATAGTGAAAGAGGCAACAAATTAAAGC
TTGGTTTTATTAGATGAATTAGGAAGAGGTACAAGCACATTTGATGGTGTATCTATAGCA
TATGGTGTTTTGAGATATCTTGTTGAGAATGTTAAATGTCTTACCCTGTTTTCAACTCAT
TATCATATGCTTGTTGATGAATTTAAACTTTACAAAAATGTTCAATCCTATGTCATGGAT
TTTGATTACTGCTCATAATAAAAGAAAATAGATTTCAAATATAAATATATTAAAGGTTCT
TCAGAAAAAAGTTTTGGTGTAAATGTAGCTAAAATGGCAGGACTTCCTGACAGTGTAATA
GATAAAGCTCATAAAATGGAACATTATATGAATTCAGAAGATTAAAATATAGGTAATGTT
CGTAGAATTACTTAAAAGTTTAATTCTATTATAGAAGCTTAGCATTAAAGTGACGATACA
CTTTTATAATTACTTAAAAATAGTTTTTGA


>TTHERM_00150000(protein)
MPPKKTKSSEVKESRSSSKKNVIDSEDSEDQAIKKTPNTKKGSNAANAKSVLSKESSVQK
SNSSDNKRALKKIQLSESEGEDKELFPTAPAKKKSAPAPKEIIVKEEESSEDDQVVKIKN
NKNGSAAAATTTNKVAKNKKKISDNESCDEEEEQMTKNKKATNQAKNKKTDKENETKQTT
QRSSRNQKKISYKEEDEEDEYTPEQEDEDFKDEEVDEVEEDEEEGDELNSDDDFEEQGKK
NKKNGQRKNNKKANGRSEGANNEKAAKKIHKAPENADDNHIIDVQKEQGKLDIEDQYELP
YFLTKKYLKDAEGRPVDDPEYDPSTLFIPIQELKKETPLFQQYWKIKVKHFDKVVFFRFG
RNFVCFYTDAILMKKLFDCYIGVWGKRPVANIFDNHYRFYVKELLEKADKSCLVVDQVQF
SDDRSNEQYLIKREVTQIITKGTYTDYVDNVEDYNARYLMCIVESETDHSFGLVLIDCTT
HQIYLDDIKNDPAGNQIRTILRKMKPVEIHSVFNNLSEQTKNICKTTCKPQFTFDKSFEF
YELQSIFEELKNEFREKIPINNPDSMKKSNQMEIEKPKANKKNNKKNNKKKQSDDDEDGS
DESSDEEKSKSLVDEEDDDGSDSEDDIENLYKPEVKKEPKFTYGELSSDYPLLLKDIEEM
YNIDKKKFEEELQKKANRKQKNSQDMQNEEDDDEPCFDIEYQYYMMLQALMLGLSYLRKL
KLNDNVFRLGSFSLLDSTVQKNTFLHLDAHAIENLDIFEVNLQNRVTSEGSLMSFIDYTK
TQFGKRMLKRWLSYPLKSIQQIEQRQEAIEDLMKIEDVIEQFDKKLSKLGDVERQISKIF
NSSQKSRLKPTSFENFSNVRLKDAYSLVEDLKNLEEILLIFKDYQDNFNSTKLKKLVTVK
DPEQINKILESTRQKNNSQTYLSQKLLNRQSSTNSKSKQQIIVGIFPDLKPFVELIQSQL
EQDEQGYCQPKQGADAVYDEIVFKMKKIYKKMNNEALVWRKKFNNNQDIKLIKSKMQWEI
QIPEKLVEGSKKPKELYLTSKVKGYQRFQTDKIISLCAKLKKVEVQLQKALSPFCERFFH
LFYQNRELLYQAVNCIGELDCLCSLAKCSLNLKIRCKPTFIPESLNKNVFELIEMYHPQL
LKENKKNLVPNDTIFEDNVTCMLVTGPNMGGKSTLLRQNCLAVILAQLGCFLPAKSFKTI
IRDRIFCRIGASDRLLEGKSTFLVEMEETGDIVKEATNQSLVLLDELGRGTSTFDGVSIA
YGVLRYLVENVKCLTLFSTHYHMLVDEFKLYKNVQSYVMDFDYCSQQKKIDFKYKYIKGS
SEKSFGVNVAKMAGLPDSVIDKAHKMEHYMNSEDQNIGNVRRITQKFNSIIEAQHQSDDT
LLQLLKNSF


>TTHERM_00150000(gene)
ATGCCTCCTAAAAAGACTAAATCAAGCGAAGTAAAAGAAAGCAGATCTTCTTCTAAGAAA
AATGTTATTGATTCTGAAGACAGTGAAGATCAAGCTATTAAGAAAACACCTAATACTAAA
AAAGGATCAAATGCTGCAAATGCAAAAAGTGTTTTATCAAAAGAAAGCTCAGTTTAAAAA
AGCAACTCATCAGATAATAAAAGAGCTTTAAAAAAAATCTAATTAAGTGAATCTGAGGGA
GAAGATAAAGAGCTTTTTCCCACAGCACCTGCGAAAAAGAAATCTGCTCCTGCTCCCAAA
GAAATTATAGTTAAGGAAGAAGAAAGTAGCGAAGATGATTAAGTTGTGAAAATTAAAAAT
AATAAAAATGGATCAGCTGCTGCTGCTACAACAACAAATAAAGTTGCTAAAAATAAAAAG
AAAATTAGTGATAATGAATCTTGTGATGAAGAAGAAGAATAAATGACTAAAAATAAAAAA
GCAACAAATTAAGCTAAAAATAAAAAAACTGACAAAGAAAATGAAACTAAGTAGACTACC
TAACGCTCGTCAAGAAATTAGAAAAAGATTTCTTACAAAGAAGAAGATGAAGAAGACGAA
TACACTCCTGAATAAGAAGATGAAGATTTTAAGGATGAAGAAGTTGATGAAGTTGAAGAG
GATGAAGAAGAAGGAGATGAGCTTAACTCAGATGATGATTTTGAAGAATAAGGCAAAAAG
AATAAAAAGAATGGATAAAGAAAAAATAATAAAAAAGCAAATGGAAGAAGTGAAGGCGCA
AATAATGAAAAAGCTGCTAAAAAAATTCATAAGGCTCCAGAAAATGCTGATGACAATCAC
ATAATAGATGTATAAAAAGAATAAGGAAAATTGGATATAGAAGATTAATATGAATTGCCA
TACTTTTTAACAAAGAAGTATTTAAAAGATGCAGAAGGTAGACCAGTAGACGATCCTGAG
TACGATCCATCAACTCTGTTTATCCCTATATAAGAGTTAAAAAAGGAAACACCTCTTTTC
TAGTAAATTTGATATTAAAATTTAATAATATAATAAAAATGTTTTTTTTAAAATAAATTA
ATAGATAATATTGGAAAATTAAAGTAAAGCATTTTGACAAGGTAGTGTTTTTTAGATTTG
GAAGAAATTTTGTTTGCTTTTATACTGATGCCATTCTGATGAAAAAGCTCTTCGATTGCT
ATATTGGAGTCTGGGGCAAAAGACCTGTTGCTAATATTTTCGATAATCACTATCGTTTTT
ATGTAAAAGAACTTCTCGAAAAAGCAGATAAGTCTTGTTTAGTTGTAGATTAAGTTCAAT
TTTCAGATGATAGATCAAATGAATAATATCTTATTAAAGTAATTTTTAGTTTAAATAATA
AAAAATTAATATTTTTTTTTAAAGAGAGAAGTTACCTAGATTATAACTAAGGGTACTTAT
ACTGATTATGTAGATAATGTCGAAGATTATAATGCAAGATATTTAATGTGTATAGTAGAG
AGTGAAACTGATCATTCATTTGGTTTAGTTCTTATAGATTGTACAACCCATCAAATATAT
TTAGATGATATCAAAAATGACCCAGCAGGAAACCAAATTCGTACAATTTTAAGAAAAATG
AAACCTGTTGAAATTCACTCAGTCTTTAATAATCTTTCTGAATAAACTAAAAATATTTGC
AAAACAACATGCAAACCATAATTTACATTTGATAAATCGTTTGAATTTTATGAGCTTTAA
AGTATTTTCGAAGAGCTTAAAAATGAGTTTAGAGAGAAAATTCCAATTAATAATCCCGAT
AGTATGAAGAAAAGTAATTAAATGGAGATAGAAAAACCCAAGGCCAACAAGAAAAACAAT
AAAAAAAATAATAAAAAGAAATAAAGTGATGATGATGAAGATGGATCAGATGAAAGCTCT
GATGAAGAAAAATCAAAAAGCTTAGTAGATGAAGAAGATGATGACGGAAGTGACAGTGAA
GATGATATTGAAAACCTGTACAAGCCTGAAGTTAAAAAAGAGCCTAAATTTACTTACGGT
GAACTTAGCAGCGATTATCCTTTACTATTGAAAGATATAGAGGAAATGTACAACATAGAT
AAAAAAAAATTTGAGGAAGAACTCTAAAAAAAAGCTAATAGGAAGCAAAAAAATTCTCAA
GATATGTAAAATGAAGAAGATGATGATGAACCTTGCTTCGACATAGAATACCAGTATTAT
ATGATGCTTTAAGCATTAATGCTTGGAGTAATTAACTTTAGACATTATTTTTCAAAGTAC
CAAAAATATTTTATTTAATTAAATTTAAGCTAAGCTACTTGAGAAAGCTGAAATTGAATG
ATAATGTATTTAGACTTGGTTCCTTTTCTCTTTTAGATTCAACTGTTTAAAAGAATACTT
TTCTCCATTTAGATGCTCATGCAATAGAAAATTTAGATATTTTCGAGGTCAATTTATAAA
ACCGTGTTACTTCTGAAGGGTATAAATTATAGATATTAAAAATAGTAAAAACATTAATAA
TTTCAATAATAAAGGTCTTTGATGTCTTTTATTGATTACACTAAAACTCAATTCGGAAAA
AGAATGCTTAAGAGATGGCTATCTTATCCACTAAAAAGTATATAGCAAATAGAATAAAGG
TAAGAAGCCATAGAAGATTTAATGAAAATAGAGGATGTAATTGAGTAATTTGATAAGAAA
CTCAGTAAATTAGGAGATGTCGAAAGATAAATTAGCAAAATTTTTAACTCATCTTAGAAA
TCAAGACTTAAACCTACTTCTTTTGAAAACTTCTCAAATGTCAGATTAAAAGATGCTTAT
TCTTTAGTTGAGGATTTAAAAAATTTAGAAGAAATTTTACTTATTTTCAAAGATTATTAA
GACAAGTAATTTTTATTTAACATTAATTATATATTCAAATTAAATTAATACTTTTAAAAA
TAGTTTTAATTCAACTAAACTCAAAAAATTGGTTACTGTAAAGGATCCTGAATAAATTAA
TAAAATTTTAGAGAGTACCAGATAAAAAAATAACTCGTAAACCTATCTTTCATAAAAATT
ACTTAATAGGTAAAGCAGCACAAATAGTAAATCTAAGCAGTAAATTATAGTTGGTATTTT
CCCAGACTTAAAGCCTTTTGTAGAGTTGATATAGAGTTAGCTCGAATAGGATGAATAAGG
TTACTGCCAACCTAAATAAGGAGCAGATGCAGTTTATGATGAAATTGTATTTAAAATGAA
AAAAATTTATAAGAAGATGAATAATGAAGCACTTGTCTGGCGTAAAAAATTTAACAATAA
CTAAGATATAAAATTAATAAAAAGCAAAATGTAATGGGAAATATAAATACCTGAGAAGCT
TGTTGAAGGATCAAAGAAACCTAAAGAACTTTATCTCACTTCTAAAGTTAAAGGTTATCA
AAGATTCTAAACAGATAAAATAATTAGTCTATGTGCAAAACTTAAAAAAGTAGAAGTCTA
ATTGCAAAAAGCCCTCTCTCCTTTTTGTGAAAGATTTTTCCATTTGTTTTATTAAAATAG
AGAACTATTGTATTAGGTAAAATTTTATTGACATTTAAATTATTTTTAAAATTTTTAAAT
AAATTATAAATCAGGCTGTTAATTGCATTGGTGAGTTAGATTGCTTATGCTCTTTGGCTA
AGTGTTCTCTTAATCTTAAGATAAGATGCAAACCAACTTTTATTCCAGAAAGTTTAAATA
AAAATGTTTTCGAACTTATAGAAATGTATCACCCCTAACTGCTAAAGGAAAATAAAAAAA
ATTTAGTACCAAATGATACAATTTTCGAAGATAATGTTACTTGTATGCTTGTCACAGGTC
CAAATATGGGTGGTAAATCAACACTTCTTAGATAAAATTGCTTAGCTGTTATTCTAGCAC
AATTAGGTTGCTTCTTGCCTGCTAAAAGTTTTAAAACAATTATAAGAGACAGAATTTTCT
GTAGAATAGGGTAAACAAATATCTTTAAACATAATAATTTGTAAAGATTTTAATATTCTT
ATTATTGAATTAATTTAGTGCTTCTGATAGATTACTAGAAGGAAAATCAACCTTTTTGGT
AGAAATGGAAGAGACAGGAGATATAGTGAAAGAGGCAACAAATTAAAGCTTGGTTTTATT
AGATGAATTAGGAAGAGGTACAAGCACATTTGATGGTGTATCTATAGCATATGGTGTTTT
GAGATATCTTGTTGAGAATGTTAAATGTCTTACCCTGTTTTCAACTCATTATCATATGCT
TGTTGATGAATTTAAACTTTACAAAAATGTTCAATCCTATGTCATGGATTTTGATTACTG
CTCATAATAAAAGAAAATAGATTTCAAATATAAATATATTAAAGGTTCTTCAGAAAAAAG
TTTTGGTGTAAATGTAGCTAAAATGGCAGGACTTCCTGACAGTGTAATAGATAAAGCTCA
TAAAATGGAACATTATATGAATTCAGAAGATTAAAATATAGGTAATGTTCGTAGAATTAC
TTAAAAGTTTAATTCTATTATAGAAGCTTAGCATTAAAGTGACGATACACTTTTATAATT
ACTTAAAAATAGTTTTTGA