Identifiers and Description

Gene Model Identifier

TTHERM_00149839

Standard Name

SUZ12 (Homolog of the PRC2 component Su(z)12)

Aliases

3700.m01689

Description

A component of the EZL1 complex (Polycomb repressive complex)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00149839

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_291060
Tetrahymena borealisEI9_05044.12.998830401637127e-79hypothetical protein (168 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:33412588: Xu J, Zhao X, Mao F, Basrur V, Ueberheide B, Chait BT, Allis CD, Taverna SD, Gao S, Wang W, Liu Y (2021) A Polycomb repressive complex is required for RNAi-mediated heterochromatin formation and dynamic distribution of nuclear bodies. Nucleic acids research 49(10):5407-5425

Sequences

>TTHERM_00149839(protein)
MANQKAKVIINPNINNSQAKGQRHYFESLDNFGKLIKEQDVSDLDSEYDIKDSVHQQFNQ
DILYTELDRDDQDFMSLWNQFMLKYNEKSNVKRSTSINSLNIHSLNGEFLKPSKFIFILD
EFINENFDVLKNTLRNQFLNHICTLIQYCIVTPNQFLQIALRLK


>TTHERM_00149839(coding)
ATGGCTAATTAGAAAGCAAAAGTCATTATAAATCCAAATATTAATAACAGCTAAGCGAAA
GGCTAAAGACATTACTTCGAATCATTGGATAATTTTGGTAAGTTGATAAAAGAATAAGAT
GTTAGTGATCTAGATTCGGAATATGATATTAAAGACTCGGTCCATTAACAGTTTAACTAA
GATATTTTATATACTGAATTAGACCGTGATGATTAAGATTTTATGTCTCTTTGGAATTAA
TTCATGTTAAAGTATAACGAAAAGTCAAATGTTAAGAGATCTACTAGCATTAATAGCCTA
AACATTCATAGCTTAAATGGAGAATTTTTAAAGCCTTCAAAATTTATATTTATTCTTGAT
GAGTTTATCAATGAAAATTTTGACGTACTTAAAAATACTTTGAGAAATTAATTTCTGAAC
CATATTTGCACATTAATCCAGTATTGCATAGTTACCCCAAATTAATTTTTGTAAATAGCT
TTAAGATTGAAGTGA


>TTHERM_00149839(gene)
ATGGCTAATTAGAAAGCAAAAGTCATTATAAATCCAAATATTAATAACAGCTAAGCGAAA
GGCTAAAGACATTACTTCGAATCATTGGATAATTTTGGTAAGTTGATAAAAGAATAAGAT
GTTAGTGATCTAGATTCGGAATATGATATTAAAGACTCGGTCCATTAACAGTTTAACTAA
GATATTTTATATACTGAATTAGACCGTGATGATTAAGATTTTATGTCTCTTTGGAATTAA
TTCATGTTAAAGTATAACGAAAAGTCAAATGTTAAGAGATCTACTAGCATTAATAGCCTA
AACATTCATAGCTTAAATGGAGAATTTTTAAAGCCTTCAAAATTTATATTTATTCTTGAT
GAGTTTATCAATGAAAATTTTGACGTACTTAAAAATACTTTGAGAAATTAATTTCTGAAC
CATATTTGCACATTAATCCAGTATTGCATAGTTACCCCAAATTAATTTTTGTAAATAGCT
TTAAGATTGAAGTGA