Identifiers and Description

Gene Model Identifier

TTHERM_00149290

Standard Name

None

Aliases

PreTt20688 | 12.m00362 | 3700.m00084

Description

Domain found in IF2B/IF5 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01873 ) Domain found in IF2B/IF5
  • ( PF02020 ) eIF4-gamma/eIF5/eIF2-epsilon
  • ( PF07754 ) Domain of unknown function (DUF1610)
  • ( TIGR00311 ) translation initiation factor aIF-2, beta

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00149290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04989.19.997093137033517e-262domain found in IF2B/IF5 famil
y protein (384 aa)
OxytrichaContig22174.0.g188.999409812021828e-43Domain found in IF2B/IF5
WormBaseWBGene000164963.9997566980151843e-38status:Confirmed UniProt:Q8I
7H7 protein_id:CCD66942.1
SGDYPR041W3.9997566980151843e-38TIF5 Translation initiation fa
ctor eIF5; functions both as a
GTPase-activating protein to
mediate hydrolysis of ribosome
-bound GTP and as a GDP dissoc
iation inhibitor to prevent re
cycling of eIF2
DictyBaseDDB_G02867532.9993110246221282e-28eIF5 on chromosome: 4 position
4930004 to 4931298
Stentor CoeruleusSteCoe_269812.6102790696677047e-23

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00149290(coding)
ATGGACAAAAACTTTTTGAACATCCCTTCATATATTGAAGATCCCTCCTATCGTTACAAG
ATGCCTAAAATGATCTTAAAGATCGAAGGTAAAGGAAATGGTATCAAGACTAACATTGTT
AATATGTAAGAAGTCTCTAAAGCTCTTAGAGTTCCCACTGAATATCCTTTGAAGTTTATG
GGTTTCGAATTGGGTTCTCAAATTATTTACAAAGAAAAGGGTAACGATGTTACTACTATC
ATTAATGGTGCTTTCAAGGAAGATATATTGTAAAAGCAATTAGATAAATTCATTTAAAAG
TATGTTTTATGTCCTAAGTGCACATATCCTGAATTTGTATTGAGAGTTCGTTAAGGTTTG
GTTAGTGGTAAGTGTGATTCTTGTGGTGAACGTGCTAAATGCGATAATGCTCACAAGTTT
GCTGCCTATATTGTAAAGAATCCCCCAAAAACCAAAGGTATTAACAAGGAAGAAGAAGAC
GATAAAAAAGATAAAAAAGTTGCTGCAACTGTTCCTTCCACAACTGTTACTAAGCCAGTT
AAAGAAGAAAAAGATGTCAATTTGAATATTAAAAAACTTGAAGCTTCTGATTTGACTCTT
GTTAGTGAAGAACTTGCCAAAAAAATTTAGCTTCTTACTGAAAGTATTAACAGTTAAAAG
CAAGAAAATGGTGAATTCACTGAAACTGATATTTCTCAAACTAACATTGTTAAGGAAATT
AAAGATATGAACATATAAAAAGGACTTGAAAGCTAAGTTGCTCACATTCTTTTCTAGTCT
TTATTTAGCGTTAATATTGCTCATGAAGTATAAAATAATGCCGAAGTTCTCAGTAAGACT
TTTTCTAAGCTTAAAATTCCTAATCCCGAACTTGAAACTATAATGAACATCAGTTATCTC
TTATTTAAAACTTACAATGAAAAGCAAGATTTCACTCCTTACGTTCCTACAATTTTAAAG
TACTTTTATGATGCAGATTTGCTATCTGAAGATTTCTTAAAAAATTATGCCGAATCTAAA
ATTAATTTGTCTGAACATTACTTATACGATGCTGAGCGTATAAAGAAGTTTGCTGAAGCT
GCTTAACCTTTCTTAGATTGGATTCTAAATGCTGAAGAAGATGAAGACGAAGAAGGTGAA
GAAGAAGAAGGAGAAGAAAAAAAAGAAGAAAGCCAATGA


>TTHERM_00149290(protein)
MDKNFLNIPSYIEDPSYRYKMPKMILKIEGKGNGIKTNIVNMQEVSKALRVPTEYPLKFM
GFELGSQIIYKEKGNDVTTIINGAFKEDILQKQLDKFIQKYVLCPKCTYPEFVLRVRQGL
VSGKCDSCGERAKCDNAHKFAAYIVKNPPKTKGINKEEEDDKKDKKVAATVPSTTVTKPV
KEEKDVNLNIKKLEASDLTLVSEELAKKIQLLTESINSQKQENGEFTETDISQTNIVKEI
KDMNIQKGLESQVAHILFQSLFSVNIAHEVQNNAEVLSKTFSKLKIPNPELETIMNISYL
LFKTYNEKQDFTPYVPTILKYFYDADLLSEDFLKNYAESKINLSEHYLYDAERIKKFAEA
AQPFLDWILNAEEDEDEEGEEEEGEEKKEESQ


>TTHERM_00149290(gene)
ATGGACAAAAACTTTTTGAACATCCCTTCATATATTGAAGATCCCTCCTATCGGTAAATA
AAATATATTATCCAATACTAGCTAAAATGATATTGCTCTTCAAAACAATTAAAAGAAACT
AATTTTACCTGTTTTTTAAACGGATTGTTTCAATTTTATCCTCAAATGAATAAATTATAT
TCATTATTTAGATGATAAAGTGTATGGAAGAAATATGAAGAGAAAGCACTTAGATTAGCA
AAATTAAATAAATAATTTTAATATTAAATAAACAAGTTACAAGATGCCTAAAATGATCTT
AAAGATCGAAGGTAAAGGAAATGGTATCAAGACTAACATTGTTAATATGTAAGAAGTCTC
TAAAGCTCTTAGAGTTCCCACTGAATGTAATAAATCAATAAAATGCTTTTATTATCACAT
TTTACAATAAAAATAATTTTGAATCAAATCATCAAATTAAAAAGTCATAAAATCGCTCTA
AAAAACATAAATATGAGGATAAGTTTTTGTACTGCAATCTACCAAACAAACTCAACAACA
ATATTTATTCCTGATCCAAAATTTTGATTAAAAATGGAGATTTAATAAATAATTTCTAAT
TTATAAAAGATCCTTTGAAGTTTATGGGTTTCGAATTGGGTTCTCAAATTATTTACAAAG
AAAAGGGTAACGATGTTACTACTATCATTAATGGTGCTTTCAAGGTAATTACTCTTATTA
TTGTTTTTTTTCTTTTTATAGTTATCTACCTACCTTGATAGCTATTTTTTTTAAACTCCT
AGTCAAGTATATAATTTGTCTATAAGATATTTCTCAAAAATTAAGAAAATCATACACAAA
AAAATAATTAAATAGCTAATCTTATGAATATATTTATTTATTTAGTTATTAGAAAATCGT
ATCATGCACAATTATCTAAAGCCTAATTTATTTGATTGAAAAAAATTATTATCATATTTA
AAACCTTATTCTAAAAAATAAACAGGAAGATATATTGTAAAAGCAATTAGATAAATTCAT
TTAAAAGTATGTTTTATGTCCTAAGTGCACATATCCTGAATTTGTATTGAGAGTTCGTTA
AGGTTTGGTTAGTGGTAAGTGTGATTCTTGTGGTGAACGTGCTAAATGCGATAATGCTCA
CAAGTTTGCTGCCTATATTGTAAAGAATCCCCCAAAAACCAAAGGTATTAACAAGGAAGA
AGAAGACGATAAAAAAGATAAAAAAGTTGCTGCAACTGTTCCTTCCACAACTGTTACTAA
GCCAGTTAAAGAAGAAAAAGATGTCAATTTGAATATTAAAAAACTTGAAGCTTCTGATTT
GACTCTTGTTAGTGAAGAACTTGCCAAAAAAATTTAGCTTCTTACTGAAAGTATTAACAG
TTAAAAGCAAGAAAATGGTGAATTCACTGAAACTGATATTTCTCAAACTAACATTGTTAA
GGAAATTAAAGATATGAACATATAAAAAGGACTTGAAAGCTAAGTTGCTCACATTCTTTT
CTAGTCTTTATTTAGCGTTAATATTGCTCATGAAGTATAAAATAATGCCGAAGTTCTCAG
TAAGACTTTTTCTAAGCTTAAAATTCCTAATCCCGAACTTGAAACTATAATGAACATCAG
TTATCTCTTATTTAAAACTTACAATGAAAAGCAAGATTTCACTCCTTACGTTCCTACAAT
TTTAAAGTACTTTTATGATGCAGATTTGCTATCTGAAGATTTCTTAAAAAATTATGCCGA
ATCTAAAATTAATTTGTCTGAACATTACTTATACGATGCTGAGCGTATAAAGAAGTTTGC
TGAAGCTGCTTAACCTTTCTTAGATTGGATTCTGTATTTATTTTATTTTTGCTTACTTAT
TATATATTTAACAAATGAATTTAAAAAAGAAATGCTGAAGAAGATGAAGACGAAGAAGGT
GAAGAAGAAGAAGGAGAAGAAAAAAAAGAAGAAAGCCAATGA