Identifiers and Description

Gene Model Identifier

TTHERM_00147640

Standard Name

None

Aliases

PreTt20622 | 12.m00296 | 3700.m00019

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • SRP-dependent cotranslational protein targeting to membrane (IEA) | GO:0006614

Domains

  • ( PF00261 ) Tropomyosin
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF08492 ) SRP72 RNA-binding domain
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF08385 ) Dynein heavy chain, N-terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00147640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04921.19.997093137033517e-262hypothetical protein (646 aa)
OxytrichaContig4928.0.g1030.000000000000004001928599951003SRP72 RNA-binding domain
WormBaseWBGene000172450.000000000800327577657144Signal recognition particle su
bunit SRP72 status:Partially
_confirmed UniProt:P91240
protein_id:CCD69012.1
DictyBaseDDB_G02914120.0000000020002373268528243srp72 on chromosome: 6 positio
n 275731 to 278168

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00147640(coding)
ATGGATAATACCTAAGTAGAAACATTATATTAGCGTTTATCAGAATGCATTAAGGAAAGA
AATCATGATCAAGTAGTCAAAGTCTGTGACTAAATCTTGTAAAAGAAGTAAGATGATAAA
GTTTTAAGATGTAGAATGGTTGCTTTGCTTAAATCAGAAAAATACACAACTCTTTAAGCT
GAATACGAAAAAGGTGGAGCAGGTTAAGGTGATGAGCAATAATAGCTTGCATATGCATAT
TATCTTTACTGCAGTGAAAAATATGATGATTGCTTAAAGTTTTTAAATTAGGCTAATAAT
CAATCAATGCAATTTTAAGTTCTTTAAGCTTAAACTCTTAACAAACTTTCTAAATTTAGC
TTATCTGCAGAACTTTATGCTTAAATTCTTAAAAAATTCCCCAAAACCGACGATTATTCA
GATTTACTTGTTAATGCTATTGCCTCCTCCATTTAAACCAATGATTAGCAAATTTAAAAG
AACATTCAAAGTTTGGTTGAGGAATATTTGAAAAACCAAAAGTAGCCTAATAATGAACTT
ATTTATAACTATGGTACTCTTTTAGGTTGCCTTCATGAGACAGAAAGATCAAGAGATATG
CAATTAAAGTTTAAGCAAATGATCCAAGAAGATAATGATAAACAAGATGAAATTATGGCT
GTTCTTTAAGCAGATTATGCTGATTTTATAAACAATAAGTACTTAGTTGGTGAAGAGATT
GAGAAAAAGATTAAATAGTATGAAGAGTTCTAAAAATAAAATTTAACTGATAAAAACTTG
AAGGCAGTATTAAATAATAATATTGTTGTTTTCCGTTATCAACATAAGCACGAATAATAT
GGTGATTCTCTTAAGTTGATTGATGAAGCTATATAGAGCAAATTCAAGTAGACCTAAGAA
TAGATATTTGTCTTTAAGCTAAATAAATCCCTTTTACTTATTTAGAAAGGTAAATTTTAA
GAAGCACTAACTTTGCTTAATGAAATCGAGCACAATTTCTCAAATCTCGATAAAAACATT
AAATTTTTATCTGTAAAGATCTATATTCTTATGAAGTCCAAAAAGGATGATTTACTTAAC
AACTTCTTAAATTAATTGAACACTAATATTTTGACTAACTCTCAAGCTCCCTATGATTTG
AGAATTGAAGTATTTTTACTTTTATCTGAAGTAGCTCGTTCATAAGGCTCTTCATAGTAA
ATCCTTTAGAATTTCTAAGCTCTTCACAATTCTACTTCTGATAAGACTCTTCTTTACGAA
AATGAGATTATCTGCTGTTTTATTCTTTCCTACATTTCAAAGATTAAATCAGATGAAAAT
ACTTCTTTAATATAACCAATATTAAATTAAATTGCTACTAACACTCACAATCCTTAAGTC
TTGTAATATCTTGGTGACGTTTATTCAAAGACTGATGCAAACATTGCACTCCAAATTTAC
ACTAAGCTTGCTTAATAATTCCCTAAGGAGAGTTCTTATTAACAACGTCTTGCTAAGTTG
CACAGCAGCAAAGGTGAATTTGAAAAAGCCCAATCCTACCTAAAAAACATCAAATTCAAC
GTTATCGAGGACTACACAGAGCTTACAAGACTTGAAAGTGAAATTGCTCTTTCTAAAATT
TAGACTAAATCTTCTACAACTCCAGCAACTCACGTTGCTAAAAAAATTACTAAACCCAAG
AAGAAAAGAGTTAGATATCCCAAGGGATTCGATCCTAAAAACCCAGGTCCTCTCCCAAAT
CCAGAAAGATGGTTACCTAAATGGGAAAGAAAAGATTTTAAAAAGAAGAAAGGAGCTGCC
CTTAATTCAAGAACTCAAGGTTCTTCAGCAGCTGCTCAAGATACTTCTACTAGCAAAACA
TTCGCAGTTAGTAACAGTACAGCTCATATCAAAGCCAAAGAAAAGAGTAAAAATAAGAAA
AACAAAAAGAAATGA


>TTHERM_00147640(protein)
MDNTQVETLYQRLSECIKERNHDQVVKVCDQILQKKQDDKVLRCRMVALLKSEKYTTLQA
EYEKGGAGQGDEQQQLAYAYYLYCSEKYDDCLKFLNQANNQSMQFQVLQAQTLNKLSKFS
LSAELYAQILKKFPKTDDYSDLLVNAIASSIQTNDQQIQKNIQSLVEEYLKNQKQPNNEL
IYNYGTLLGCLHETERSRDMQLKFKQMIQEDNDKQDEIMAVLQADYADFINNKYLVGEEI
EKKIKQYEEFQKQNLTDKNLKAVLNNNIVVFRYQHKHEQYGDSLKLIDEAIQSKFKQTQE
QIFVFKLNKSLLLIQKGKFQEALTLLNEIEHNFSNLDKNIKFLSVKIYILMKSKKDDLLN
NFLNQLNTNILTNSQAPYDLRIEVFLLLSEVARSQGSSQQILQNFQALHNSTSDKTLLYE
NEIICCFILSYISKIKSDENTSLIQPILNQIATNTHNPQVLQYLGDVYSKTDANIALQIY
TKLAQQFPKESSYQQRLAKLHSSKGEFEKAQSYLKNIKFNVIEDYTELTRLESEIALSKI
QTKSSTTPATHVAKKITKPKKKRVRYPKGFDPKNPGPLPNPERWLPKWERKDFKKKKGAA
LNSRTQGSSAAAQDTSTSKTFAVSNSTAHIKAKEKSKNKKNKKK


>TTHERM_00147640(gene)
ATGGATAATACCTAAGTAGAAACATTATATTAGCGTTTATCAGAATGCATTAAGGAAAGA
AATCATGATCAAGTAGTCAAAGTCTGTGACTAAATCTTGTAAAAGAAGTAAGATGATAAA
GTTTTAAGATGTAGAATGGTTGCTTTGCTTAAATCAGAAAAATACACAACTCTTTAAGCT
GAATACGAAAAAGGTGGAGCAGGTTAAGGTGATGAGCAATAATAGCTTGCATATGCATAT
TATCTTTACTGCAGTGAAAAATATGATGATTGCTTAAAGTTTTTAAATTAGGCTAATAAT
CAATCAATGCAATTTTAAGTTCTTTAAGCTTAAACTCTTAACAAACTTTCTAAATTTAGC
TTATCTGCAGAACTTTATGCTTAAATTCTTAAAAAATTCCCCAAAACCGACGATTATTCA
GATTTACTTGTTAATGCTATTGCCTCCTCCATTTAAACCAATGTAACTTTCTTTCTTTCG
TTTTTGAAGTTATTAAATCTTCATTAATTTATAGGTATTTCACTTTAAAAAACATAATTT
AAGTTTTTAAAATAAATTTCAATATCAGACATTTAAATTTAAGCTATAAAGTTTAACAAA
ATTGGAAGTGAAATGATTAAAAATTTATTTAAATATTGCATCTTTAGTTTATTTATTAAT
ATTTTATTTATCTAATAGGATTAGCAAATTTAAAAGAACATTCAAAGTTTGGTTGAGGAA
TATTTGAAAAACCAAAAGTAGCCTAATAATGAACTTATTTATAACTATGGTACTCTTTTA
GGTTGCCTTCATGAGACAGAAAGATCAAGAGATATGCAATTAAAGTTTAAGCAAATGATC
CAAGAAGATAATGATAAACAAGATGAAATTATGGCTGTTCTTTAAGCAGATTATGCTGAT
TTTATAAACAATAAGTACTTAGTTGGTGAAGAGATTGAGAAAAAGATTAAATAGTATGAA
GAGTTCTAAAAATAAAATTTAACTGATAAAAACTTGAAGGCAGTATTAAATAATAATATT
GTTGTTTTCCGTTATCAACATAAGCACGAATAATATGGTGATTCTCTTAAGTTGATTGAT
GAAGCTATATAGAGCAAATTCAAGTAGACCTAAGAATAGATATTTGTCTTTAAGCTAAAT
AAATCCCTTTTACTTATTTAGAAAGGTAAATTTTAAGAAGCACTAACTTTGCTTAATGAA
ATCGAGCACAATTTCTCAAATCTCGATAAAAACATTAAATTTTTATCTGTAAAGATCTAT
ATTCTTATGAAGTCCAAAAAGGATGATTTACTTAACAACTTCTTAAATTAATTGAACACT
AATATTTTGACTAACTCTCAAGCTCCCTATGATTTGAGAATTGAAGTATTTTTACTTTTA
TCTGAAGTAGCTCGTTCATAAGGCTCTTCATAGTAAATCCTTTAGAATTTCTAAGCTCTT
CACAATTCTACTTCTGATAAGACTCTTCTTTACGAAAATGAGATTATCTGCTGTTTTATT
CTTTCCTACATTTCAAAGATTAAATCAGATGAAAATACTTCTTTAATATAACCAATATTA
AATTAAATTGCTACTAACACTCACAATCCTTAAGTCTTGTAATATCTTGGTGACGTTTAT
TCAAAGACTGATGCAAACATTGCACTCCAAATTTACACTAAGCTTGCTTAATAATTCCCT
AAGGAGAGTTCTTATTAACAACGTCTTGCTAAGTTGCACAGCAGCAAAGGTGAATTTGAA
AAAGCCCAATCCTACCTAAAAAACATCAAATTCAACGTTATCGAGGACTACACAGAGCTT
ACAAGACTTGAAAGTGAAATTGCTCTTTCTAAAATTTAGACTAAATCTTCTACAACTCCA
GCAACTCACGTTGCTAAAAAAATTACTAAACCCAAGAAGAAAAGAGTTAGATATCCCAAG
GGATTCGATCCTAAAAACCCAGGTCCTCTCCCAAATCCAGAAAGATGGTTACCTAAATGG
GAAAGAAAAGATTTTAAAAAGAAGAAAGGAGCTGCCCTTAATTCAAGAACTCAAGGTTCT
TCAGCAGCTGCTCAAGATACTTCTACTAGCAAAACATTCGCAGTTAGTAACAGTACAGCT
CATATCAAAGCCAAAGAAAAGAGTAAAAATAAGAAAAACAAAAAGAAATGA