Identifiers and Description

Gene Model Identifier

TTHERM_00144940

Standard Name

None

Aliases

PreTt26702 | 11.m00399 | 3702.m00121

Description

cyclin-dependent kinase-like Serine/Threonine kinase family protein; Protein kinase domain containing protein. Sequence similarity to the RCK protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF05972 ) APC 15 residue motif
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF00357 ) Integrin alpha cytoplasmic region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00144940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04770.19.997093137033517e-262protein kinase domain-containi
ng protein (1224 aa)
OxytrichaContig15886.0.g144.000049796805715e-127Protein kinase domain
WormBaseWBGene000011212.9992439173235726e-110locus:dyf-5 status:Confirmed
UniProt:B3WFY8 protein_id
:CAQ76489.2
DictyBaseDDB_G02680781.0001900614163146e-108DDB_G0268078 on chromosome: 1
position 1417972 to 1419590
SGDYBR160W2.9992141389250636e-57CDC28 Catalytic subunit of the
main cell cycle cyclin-depend
ent kinase (CDK); alternately
associates with G1 cyclins (CL
Ns) and G2/M cyclins (CLBs) wh
ich direct the CDK to specific
substrates
Stentor CoeruleusSteCoe_228205.166420632837861e-55

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00144940(coding)
ATGGATAAGTATAAAATTACAAAAAATTTAGGTGACGGTACATATGGTACTGTTGTTGAG
GCAATTAACATAGAAAAAAATGAAAAAGTAGCTATTAAATAAATGAAATAAGAATTCAAA
AGTTGGGAAGAATGTATAAATCTGCGAGAAATAAAATCATTAAGAAAGTTGAACCACCCT
AATATTGTAAAGCTCAGAGAAGTACTTAAAATTAACAACGAACTATATCTGGTATTTGAG
CATATGGATATTAATATTTATCAATACTACCTCTCTTTCAAAGAAAAAAAGTAAAAAATG
CCAGAGAGAGTTATTAAATCTATTATTTTTTAAACTGCCTTAGGATTAGCTTACATGCAT
AAGCATGGCTATTTTCATAGAGATCTTAAACCTGAAAACCTTTTAATCAGTGAAGACAGG
CAAGTCTTAAAAATATGTGACTTTGGTCTGGCTAGAGAGATTCGCTCTCGTCCTCCATAT
ACTGATTATGTTTCTACACGTTGGTACCGTGCTCCTGAGTTATTATTAAAAAGTACAACT
TATAACTCTCCCGTTGATATATTTGCGTTAGGCTGTATAATGATTGAGCTTTATATGCTC
AACCCATTATGGGCAGGTGCCAGTGAAATAGATCATCTTTATAAAATGGTAGAAACTCTA
GGAACACCAAACTAATAAACATGGCCTGACGGATAGAAACTAGCCAATTAGACAGGAATA
ATGTTTCCACAAAAGTAGGAAAAAGTACCTCTGTAGCAATATATTCCTCATGCTAGTGCA
GAAGCAGTATAACTTTTAGAAATGATGTTATAATACGATCCTTCTAAGCGCCCAACAGCT
GCTTAAGTTTTACAGCATCCTTACTTTATAGGTCTAAATAATGGTAGCCAAAATAACTCT
TCAACTCCAGTTAGTTCAAGTAACTTAGGGATGCAGGGAGCAAGCTCTTCTTAGCCGTAA
ATATCAATAGCAGACTCATATGAATAGAATTTGAAGAAATATGAAAAATAATAAAATTCT
CAACCTCAAGGAATAAATAATAACTTATATGAAAACCAAATTCCTCATGCTTCGTATTTT
GTAAAAACCGAAACAGAAAAAGTAAATAGGGAGTTATATCAACAAAAAGAAAATTAAAAT
AAAATAATAGATGATTCATTGTGGAATTACACAATTAATAATAATACTTATAACATTAAC
AACAACAATAATAACAATAATTAAAATTAATAAAATAACAACTATAATATATTAACTAAT
AATAATGGAACAAGATAAAACTAATTTAAGTAGGGAGGATTAGGAATTAACTCAATTAAA
AATCCTGGCTTCTCAAATAATTTCTATTCGAACGAAAAGCCAACTAATTTTTCTTTGAAT
AAATATAATTATTAGTCATAATTAAGTTAGTAATATGGGAGTAGTCTACATAATAACTAA
GGTATCTAATAATTAAACCAGTAAGGATCGTTACCCTAAAAACAAGGGAAAAATATGTAT
AAAAATAATTTTGCTGGAAATGCAACTTGGAATCTCTCCGAATACAAAAACAATAACTAT
AACTTTTAATAAGGTGGGGTCCAAAATTTAGGTTAATCTAATCATAGCTCGAATTATTAC
AATAGTTAAAATCCTGGTTAAAATTATAACACGAATATTAACTAGTAACAAATTAATTTA
GCTCAAACAATTAACAACACTAACAGCAACAACTAAGTACCAAATACATAAAGAAATATA
TTCAATAATGGTGCTGCATTTTTGCTTAACAGCAGCTATAAAAATTAATTTAAATATTCT
CCTCAATTTAATTAATCCTCCAGTAATAACTAAGTTAGTTAAAATTAGAACGCATAAAAT
TAGTTTAACTAATCAAACTCTCCTTCAAATGAAAAATATCACGATGTAAAGTAGTTGCAA
TAAAAGTACAACTTTGATAAATTAAAAGAAATGTACTGA


>TTHERM_00144940(protein)
MDKYKITKNLGDGTYGTVVEAINIEKNEKVAIKQMKQEFKSWEECINLREIKSLRKLNHP
NIVKLREVLKINNELYLVFEHMDINIYQYYLSFKEKKQKMPERVIKSIIFQTALGLAYMH
KHGYFHRDLKPENLLISEDRQVLKICDFGLAREIRSRPPYTDYVSTRWYRAPELLLKSTT
YNSPVDIFALGCIMIELYMLNPLWAGASEIDHLYKMVETLGTPNQQTWPDGQKLANQTGI
MFPQKQEKVPLQQYIPHASAEAVQLLEMMLQYDPSKRPTAAQVLQHPYFIGLNNGSQNNS
STPVSSSNLGMQGASSSQPQISIADSYEQNLKKYEKQQNSQPQGINNNLYENQIPHASYF
VKTETEKVNRELYQQKENQNKIIDDSLWNYTINNNTYNINNNNNNNNQNQQNNNYNILTN
NNGTRQNQFKQGGLGINSIKNPGFSNNFYSNEKPTNFSLNKYNYQSQLSQQYGSSLHNNQ
GIQQLNQQGSLPQKQGKNMYKNNFAGNATWNLSEYKNNNYNFQQGGVQNLGQSNHSSNYY
NSQNPGQNYNTNINQQQINLAQTINNTNSNNQVPNTQRNIFNNGAAFLLNSSYKNQFKYS
PQFNQSSSNNQVSQNQNAQNQFNQSNSPSNEKYHDVKQLQQKYNFDKLKEMY


>TTHERM_00144940(gene)
ATGGATAAGTATAAAATTACAAAAAATTTAGGTGACGGTACATATGGTACTGTTGTTGAG
GCAATTAACATAGAAAAAAATGAAAAAGTAGCTATTAAATAAATGAAATAAGAATTCAAA
AGTTGGGAAGAATGTATAAATCTGCGAGAAATAAAATCATTAAGAAAGTTGAACCACCCT
AATATTGTAAAGCTCAGAGAAGTACTTAAAATTAACAACGAACTATATCTGGTATTTGAG
CATATGGATATTAATATTTATCAATACTACCTCTCTTTCAAAGAAAAAAAGTAAAAAATG
CCAGAGAGAGTTATTAAATCTATTATTTTTTAAACTGCCTTAGGATTAGCTTACATGCAT
AAGCATGGCTATTTTCATAGAGATCTTAAACCTGAAAACCTTTTAATCAGTGAAGACAGG
CAAGTCTTAAAAATATGTGACTTTGGTCTGGCTAGAGAGATTCGCTCTCGTCCTCCATAT
ACTGATTATGTTTCTACACGTTGGTACCGTGCTCCTGAGTTATTATTAAAAAGTACAACT
TATAACTCTCCCGTTGATATATTTGCGTTAGGCTGTATAATGATTGAGCTTTATATGCTC
AACCCATTATGGGCAGGTGCCAGTGAAATAGATCATCTTTATAAAATGGTAGAAACTCTA
GGAACACCAAACTAATAAACATGGCCTGACGGATAGAAACTAGCCAATTAGACAGGAATA
ATGTTTCCACAAAAGTAGGAAAAAGTACCTCTGTAGCAATATATTCCTCATGCTAGTGCA
GAAGCAGTATAACTTTTAGAAATGATGTTATAATACGATCCTTCTAAGCGCCCAACAGCT
GCTTAAGTTTTACAGCATCCTTACTTTATAGGTCTAAATAATGGTAGCCAAAATAACTCT
TCAACTCCAGTTAGTTCAAGTAACTTAGGGATGCAGGGAGCAAGCTCTTCTTAGCCGTAA
ATATCAATAGCAGACTCATATGAATAGAATTTGAAGAAATATGAAAAATAATAAAATTCT
CAACCTCAAGGAATAAATAATAACTTATATGAAAACCAAATTCCTCATGCTTCGTATTTT
GTAAAAACCGAAACAGAAAAAGTAAATAGGGAGTTATATCAACAAAAAGAAAATTAAAAT
AAAATAATAGATGATTCATTGTGGAATTACACAATTAATAATAATACTTATAACATTAAC
AACAACAATAATAACAATAATTAAAATTAATAAAATAACAACTATAATATATTAACTAAT
AATAATGGAACAAGATAAAACTAATTTAAGTAGGGAGGATTAGGAATTAACTCAATTAAA
AATCCTGGCTTCTCAAATAATTTCTATTCGAACGAAAAGCCAACTAATTTTTCTTTGAAT
AAATATAATTATTAGTCATAATTAAGTTAGTAATATGGGAGTAGTCTACATAATAACTAA
GGTATCTAATAATTAAACCAGTAAGGATCGTTACCCTAAAAACAAGGGAAAAATATGTAT
AAAAATAATTTTGCTGGAAATGCAACTTGGAATCTCTCCGAATACAAAAACAATAACTAT
AACTTTTAATAAGGTGGGGTCCAAAATTTAGGTTAATCTAATCATAGCTCGAATTATTAC
AATAGTTAAAATCCTGGTTAAAATTATAACACGAATATTAACTAGTAACAAATTAATTTA
GCTCAAACAATTAACAACACTAACAGCAACAACTAAGTACCAAATACATAAAGAAATATA
TTCAATAATGGTGCTGCATTTTTGCTTAACAGCAGCTATAAAAATTAATTTAAATATTCT
CCTCAATTTAATTAATCCTCCAGTAATAACTAAGTTAGTTAAAATTAGAACGCATAAAAT
TAGTTTAACTAATCAAACTCTCCTTCAAGTAAATATTTTATTAAATTTCATTGAGATTTC
AAAATAAACATTTAATTTATAACTTTTTTCAAAAGCAATTTTAAATATTCTTTTTTATTA
AAAAATAGATGAAAAATATCACGATGTAAAGTAGTTGCAATAAAAGTACAACTTTGATAA
ATTAAAAGAAATGTACTGA