Identifiers and Description

Gene Model Identifier

TTHERM_00140790

Standard Name

None

Aliases

PreTt26584 | 11.m00281 | 3702.m00006

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08737 ) Rgp1
  • ( PF07974 ) EGF-like domain
  • ( PF06943 ) LSD1 zinc finger
  • ( TIGR01612 ) rhoptry protein
  • ( PF05345 ) Putative Ig domain
  • ( PF00569 ) Zinc finger, ZZ type
  • ( PF02363 ) Cysteine rich repeat
  • ( PF00757 ) Furin-like cysteine rich region
  • ( PF04829 ) Possible hemagglutinin (DUF638)
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF03302 ) Giardia variant-specific surface protein
  • ( PF04151 ) Bacterial pre-peptidase C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14%

TetraMine Data

TTHERM_00140790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04895.19.997093137033517e-262hypothetical protein (2681 aa)
OxytrichaContig21445.0.g929.998397555368434e-52Protein of unknown function (D
UF3659)
WormBaseWBGene000009989.997764199084386e-16locus:dig-1 Mesocentin sta
tus:Confirmed UniProt:Q09165
protein_id:CCD72779.1
Stentor CoeruleusSteCoe_43530.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00140790(coding)
ATGATAAGATTATTTTAGTGTTAGCCAATTTAAAGAAATCCAGGAGCTTCAGGATTTAGT
TTAAAAATTACATTTGTGACATTTAATCCTCCATAAAATGCTAAATTCTTAACACTACAA
CTAAGTGATTTGTTGGGTATAAATTTTAGTAGTATCACAAAAATTTCATACTAAGCTGTA
AATAACGATTAATTTTGTAAACTTGACAAAACCACTTCAATAAATGCTGTATTTGATTCC
ACCCAAAAAAAAATTTCAATTCCAAATCCTTTCACAATATTAGATACTAATTCTTAAATG
CCATGTAGTGGATAAAATGTACCTCCAAATTGGTTAACTATACAAATAGTAAGTACCTTT
TAATATGGAGGAACAATAAATATTTAAACGTTTTATGACTCTGTATAATATGGCACAACT
AATTCTATTGGCCTTTCTACACCATTATAAGTATAACCAGATAATATTTTAGATGCAAAT
ATATAGTTTGGTTTCTCATCAACTACTCCATCGAAAATTATATCTGATATAGGTGAATAC
AGTTTAAAAGTGACAACTCCGACTCTCACTACAGCAATAAATTAAATTGCTTTAACTCTT
CCAATGTATTGGTATCCTGATACTCTTTTACCTGATAGTGGCTGCTAGCAAACATCAGTA
CCATAATAAGCAAGCTTCAAATCTACATTACTAAGTTCATTATCAGCAACTGTTACTACT
GATAATCCAAATGGTTTGTACAAAGTTGCATTAAGTTTCACATAAATAAATCTAAATGGT
TAAATAGTTGATTTAACTTTTTAAATGACAAATCCATTTACATCCGCTAATATAGTATTA
GAAGGAACCTAATTGATAATTATAGCAGCTTTTAATTATTAGTAGAGTCCTAGTTCAACT
GTGTATACTGCCTTTTAAACATAATTTTCAAATACTAACGTGTAAGCATCATCTAAGACA
TTTCCAGATTGTAATTAAAACGGAAATGTATAAATACTATGCTCTCCTACAAGTAATGGA
AGCTATACTAATTAAGCATGCATGTCAGGTTAGACTGTATTTGTAAAAATATTGATGTAT
CCTATTTTTTTTTAAGATATATACTCCTCTGTGTAATTTACTTTATCTAATCTTCCACCC
AATTAGCAAGCTATAACTGGTATTACGATGCAAATTTAAAATGCTGGGTCACAAGCAGAT
GCTGGGGTACCATCGAATTCTGTTAGTACCAACAATTAAGTGATATTTTTTAATCAATAT
TTAAATGGTAATGTAAATTATTAATCCTATCCATTTATTTGCATGGCTGGCATATACATA
CAATGGTTATCTATTATTATACCATCATTTTAACTTCCTTATGATATAGATGGACTTAAC
ATATCTGCATAATTCTTTGTTTAACCCTTTTTACCATTAGCAGGCTATAGTTAGTATAAA
AGGGATCTCGTTTCTGACAAAATCTTGAATACTTAATGCAGTAACACTAAAATATAAATA
AATTAAAATACTCTTAAAGCTGCTTAAGTAACAACTTCTAATTAAAATGACTTACAGGTA
GGTGCAACTTCAGCAACTCACGAATTTACAATTAAAAGCTAATTTTCATTTCTTTCTACA
TCCGGAAAAATTTAACTTACTCTTCCCTCATCTTTATCAATAAATGCTGGTGGAACCTTT
TCTTGTACTTTAAAATTTATTCTTACTGATAATTCACTGCTTTCTAATCCCACTACATGC
ACAAAAGCTGGTACACCTACTGTTGTTACCTTGTCATATACATATTCTGGAACTTAAAAG
GCTATTGGATTTGTTTTTACTATAAATCAAGTGAAAAACCCAACAATAATATAATTTTCA
AAGTTTTCAGTTTAAACATTCTTGAGAAATGGTGGTCTTTCTGAGTCTAATGATAATTCA
AATACTTTTGGGTTTACCACTCTACCTGCTCCTTTTACTACAGCCTAGCTAGTAAATAAT
GCTCCAGGAGTAAAGAATGTTTACACGCTTTCTCCTTACAAACTTACACTTATCTCACCA
GTTGATTTGCTAACCACTAACTAAATTATTGTTAATTTTCCAAATTATGTTTTAGAAATA
AATAATATATCTGTTACTAGTCCTTCAACTGGTATCACTACTTCATCAAATAATTAATTT
CCATTAACATTGACATTTACTCAATAAATTACTGCTAATACTCCAATTAATGTGCAGTTT
ACTATAAGAAATCCACCAGTTTCAAATTTAGACTACTAATTTTAAATTGTTGCATATGAT
GTTACACCAGATAAAACTTTTTTATAAAGCACTATTAACTATGGTAGTACAGATAATATT
AAATTAGTAGGTTTTTCATCTTTTGGGGTAATTTCAAGTAGTCCTTAAAATTTAGCAACA
GCTGTGTTTACAGTATCTTTCAATCCTACTGTACTACTTGCCAAACCGTCTATAATGATT
TTAACTTTTACAGCACCAACTAATACTCATAATTTTCTAATAACTGCATAAACAACTTGC
TCACCTATCACACCAGGGCTTACTCTAAGCTGCACTATTAATACACCTTCAACTAATTAG
TTGACAGTTACTTTCAATACCGATATATAGCCATCTACAAACTATCAATTTAATATTTAA
AATGTTTTAAATTATTTGAGTACATCTCCATACCAAATAACAGGAGATCTTGGGTACTCA
TAAAATTAGGTTGGAAATGAATCATCTTAGACTATTTAAAATACATAATTTTAGAGCTTA
TCTACAGTATAATTGGTGATTACAAACAGCTAACTAGGAATTGCAAGTTAATATTAATTT
AATATCTAAACAGTATCTCCTTTCCCATAAAATGGTAATATAGTTGTAACAGCAACTGAT
CTAGTATAATTTGTACTGCCTTCTAGTGTAACTGTAAATTTATCTACTTGTACAGGGTCA
GCGGGTGATACTACATCTAAATTAACTTTATCTTCTTGCTATCCAAATTAAGACCCATCC
TTGATTACAATGTCTGTTAATAATCCTAACTAATTAATTCAGAACTCAAATACTCCATTC
ACTATAACTCTCAATGAAATAGTTGGCGGAACGCTTTATCCAATTAAATAATACACTTCT
CCTAATCTCGTATACAAGAATAAATGTAATGTATCATCATTTTGTAAAACTTGCTAAGAT
GCCAATCCTTCAAGCTGCTTAACTTGCTATCCTCAAAATACTATTTATTATTAATCTTAA
AATGTATATGTTTAAGAAATAATTTTAAATAGTGTACCTGCTGTTCCAAATTGTGTGGCT
AGCTGTCCAGCATAGTCTTACTAAACTACTCAAAGTGGATAAAGTATATGCGCATCATGC
AGCCCGCCATGCACAGCTTGTATGAATTCATCTACTTTTTGCACTTCCTGCTCAGGCAAT
CTTTACTTAGATCCAACAATAAACACTTGCAGCGCAAATTGTCCTAATCTATATTTCTAG
GGATCTAACAATAAATGTTAACTTTGCTCAACTGTAGGAAATTGTTTAACTTGTTCTTCT
GCTGGTGTATGCACTTCATGCGATCCCAACTTTTATAAAAAATAAAATACATAATGTGTA
ACCTAATGTGATAGCTCATATTACCTAGCTAATGGAGGAACAGAATGTAAACCTTGCCCC
ACAGGATGCAATACTTGTACTTCTGATACAAACTGTACCGCTTGCTCTGTTGGATATATT
AAATATTAAACAACATGTGTTTCAAGCTGCCCTTCAGGATATTCAAGGCTTATGCAAGGC
GGAGTATATGTTTGTGGTCTATGTGATCCAAATTGCTAAGCTTGTGATACCATAAGCACT
ACTTGTACTTCTTGTTACCCTAACACATATTTGTATAACTAAAAATGTATTACATAATCT
TAAATACCTGCTGGTAACTTTGGAGACAATGCAACATGGACAGTCTAACCTTGCATGAAT
TATTGTGTTGCATGTTCTTATAAATCACTGTGTACTACATGCTCTTAATCAGCAGTTGTT
TATTAAGGTGTCTGTTACACTACTTGTCCTAGTAGTGCTCCTGTACCAGACGGAGCTGGT
GGTTGTAAATAGGCAATTGTGCCGGCAGCAGTATCAGATAATAGCTCTAAAGTAGTACCC
TTCCCTATGCTTTTGTCATGCATAGCATTCTGCATATCTGTATACTTCTCTAAATATGAA
AAACCTCAAACATTTGTTCCTGGTTGCATTGTGGGTTTTTGTGCTCTCTTTGAATGGATA
TCTTGGATAATATTGATAGCGATATGCTATTTAAATGATGGAATTATGTCAATAACTACA
ATTGCTGCTGCCGTAGGATTCGTCCTTATTTACCTATTTAATTTAGTTTATTACATATTA
TACAGAAAAACAATATCTAAAGATACCTCATTTATGGAGTGGGAATTATCTCATAAAAAT
AGGATGTGTAAAAATGTATCAATATTTTTTTCATGCCTCATTTCCTTCAAAATTTAAAAA
ATTATCTTCTGCAAGTATTTTAACTAAAACTTTTTTAAGGCAAAACTTAAAGATATTGAC
TTATTATCTCCTTTCAATAAAGTTTCTGTGCTAAGTGTTATATTTAATAGCTTCTTAATT
ATTTTAAGTGCAGCCATATTTAGCTATAAATATCAAAATTCCACTTAGATTTATATTTTA
AGTCTAGATACATTGCTTGTGACCATTTTTATGATTATTTTCATGATTTGGGAGGCATTG
AAGAATGAAACCTTCTTTGAAGAAAACTACAATATGAATTTTGAACAAATGAGCTAATTT
ACTCAACGATTCTTCCCCTTCGACTAATCTTACATGGAGAGGGCAAGGTAAAGATCAGTT
TATGGACATCTTAAAAAATCAGAGTCAAATTCTAGTCTTACCGAATTTGGCAAGGATAAC
AAAGTGACTAAAGTAGAACAATTACAGTAACCTTACAGTTAAGTAATGGACCCAAATGAT
ATTTCAACAAATGCCGCTATAGATAGAAATGTATTAAATAACTCTAATAATGGAGCACCT
TATCTTATTCAGGATGAGTTATCAGAGTCCTCTAAACCTGGAAAAAAGAGATAATTTGAG
AAAAAGCATGTTGCTCCTGTATTTGACCATAAAAATTTCCCACCTATAGAAGAAAACTCA
TTAGAAGATGAGGATGAAGATTATTATGATGAAGATTATTAGAATCAAACTATGAAAAAA
ATGGTTGGGGCCTCTAATATGGCAGGTTTAGCAAATTCAAAAGGCTTTGATAAAAATAAA
ATGATATCTCTGGATGATTAAGAAGATTTAGAAAATTAAAGAAACAAAAATTTAAATAAT
TCAAACTAATTTTAAAACAGTAACGGCTTCAACAAAAATAATGGTAGTGATTAAGTCCCC
TCATAGTTAAATTAAAGTCACACAGTTTACTATGATCCTTAAGATCCTTCAGGATAAATG
ATGAACAATGTAAGTATGGGAGTAGGATTGCAAGAAGATGAAAATGATGGAGAAGGAGAA
GAGGTACGCTAACGATTATTTTCTAAATAGTCTGGTGATGAAAATATGAAAGAAAAAGCA
GCTTTGATTGCAGGTACTTCTTTAATTGGAGGAGCAGTAGTAGGTGCTGCAGCTGCCTAA
AGTGCAAATAATAAGAATGAATAATAGTAATTAGTTGACTAAAATGGAAATAGGATAGAT
AAAGATGGCAATCTTATAGACAAAGATGGTAATAAAATTGATAAAGAAGGCAATAGAATT
GACAAAAACGGTAATAAGATTGATAAAGATGGAAATATGATTGATAAAGATGGTTATATA
ATTGATAAAGAGGGGAATAAGATTGATAAAGATGGAAATAAGATTGATAAAGATGGAAAT
AAGATTGATAAAGATGGAAATAAGATTGATAAAGATGGAAATAGAATTGATAAAGATGGA
AATAAAATAGACAAAGATGGTAATAGGATCGATAAAGATGGTAACAGAATTGATAAAGAC
GGTAATAGAATTGATAAAGATGGTAATAGGATTGATAAAGACGGACATAGAATCGATAAA
GATGGAAATAGAATTGACAAAGACGGGAATAGAATTGATAAAGATGGAAATAAGATTGAT
AAAAATGGTAATAGAATTGACAAAGATGGGAATAGAATTGATAAAGATGGTAATATAATT
GATAAAGATGGTAACAGAATCGATAAAGATGGAAATAGAATTGACAAAGATGGAAATAGA
ATTGACAAAGATGGAAATAGAATTGACAAAGATGGAAATAGAATTGACAAAGACGGCAAT
AGGATTGATAAAGATGGACATAGAATTGATAAAGATGGAAATAAAATTGATAAAGATGGT
AATAGAATTGACAAAGACGGCAATAGGATTGATAAAGATGGAAATAGAATTGACAAAGAC
GGGAATAGAATTGATAAAGATGGTAATAGAATTGATAAAGATGGAAATAGGATTGATAAA
GATGGTAATAGAATTGACAAAAATGGTAACAGAATTGATAAAGATGGTAATAGAATTGAC
AAAGACGGTAATAGGATTGATAAAAATGGTAATAGAATTGACAAAGATGGGAATAGAATT
GATAAAGATGGTAATAGAATTGATAAAGATGGTAACAGAATCGATAAAGATGGAAATAGA
ATTGACAAAGATGGTAACAGAATTGATAAAGATGGAAATAAAATTGACAAAGATGGTAAC
AGAATTGATAAAGATGGTAATAGAATTGACAAAGACGGCAATAGGATAGATAAAGATGGA
AATAGAATTGACAAAGATGGCAATAGAATTGACAAAGACGGCAATAGGATTGATAAAGAT
GGACATAGAATTGATAAAGATGGAAATAGAATTGACAAAGATGGTAACAGAATTGATAAA
GATGGTAATAGAATTGACAAAGACGGTAATAGGATTGATAAAGATGGTAACAGAATTGAT
AAAAATGGAAATAAATTAGATAAAAATGGAAAGGTTTTAGATGATAAAAACAAAAAGGCT
GAAGATGACATGTTGTTTTATTTTAATAATCCTCTTAACGACTAAAATGAATAAAATAAA
AACAACCAAAAGGAAGGATAATAGGATAAGACAAAAAAAGCTTAAAATTTAGATGAAAAT
AAGGTAGAGAAAATTATGCCAGAAGTCGAAGATTTGGATGAGGATTTATCTAAAAAAGAT
AAAAACTAAAATGAAATGGGTAAAAATAAGAAAATGATAACTCCTAATGATATTGTAAAA
GGAAACAATAAGAATCAGAAAGGTCCATAAAAGAACAATTTGTTTGGTACTTCAGATGAT
GAAGGAGCTAATCAAAATTCAAAAAAGAAAAAAGGACAATCTGAAAAAAAGAACAATATT
TATGATTCTGATGAAAGTTTGCACACAGCTAGTGAGGCGGAAATGAATTTCAATGAAATT
AGTCCAACAGACTTCAATATACTTAACTAAAGATATGAAGAAGACTATTTTGTTTAACCA
CCTTAAAGTGCACTTTAAATGTAACTTCTCTAATAAAGCTTGAGTTAACTAAATAGAAAT
ATTTCTAGCAGCCAAAGTTAAGCCTTTATGAATAATACTGGGTTCGATGGAAATAATACA
AGGTAATCATAACCATAGGCAGGATAGTTCACAACTGGAGTTGGAAATAGCTAAGGATTT
GATAAAAAGATGGTGAATTAATTTGGTTAGAACAATATTGATGGCTCAAGCAAATTATAA
CAAAATTAATAAAAGTAAAAGACTTTACAGCCAAGTAACTCGAATTTATCTATGAACAGT
TAAAATCCATAAAATGGTATGAACAAATCAAATAGTCCAGTGAAAAGGTAAAAGCAGGTT
GGACTTAATAACTCACGCTCTTAAAATGTTAATGCTCTCTCAGTAGACATAAAGCAAAAT
ACTTAGCCTAACATTTAAGGATAGAGCAATAATCTAAGTACAATCAACTCAAATAATAAT
GGAAATATTAATCCTATATTAGCTAATCCTAATGCAAATGGCAATACAACAGACTAACTC
TTAATAGAAAACTTCGATGATTTTAATAATAACACTTCTTCTTAAACTGCTATACCTTAA
GGTTTTTACCAAAATCAATTTAATTCAAGTTTTAACAATTAAGATCCTCGAATGAGCTAC
ACTTAAATGAATAGAGGCAATCTAAGTAGTAGGTCTAAAGGTAATTCACCTTCAAGTTAG
AATATAGCTTACAAAGTTCCTGCTGTTGACGTAAACAAATTAAAGAATTTAGAAAAGATA
TATCTTCAAAGAATAGAAGCTAATGTTAATTCCTCATAAAGCTCTAGAAAGAATGCCTTG
AAAAAGAAAAAAAAGAAAATCTAGAGAGAATTATCACACACGTCTAATCTTTAAGTAAAT
CCAACTTAAGGAATGAAATCTCCTGGAGACATGTCTGAAATTTATTTTGGAGAAAGAGGT
TAGAAATTTGACCCTACAATGTTAGACCATAATGGAGAAGAAGTTATTGATTTTGATGAT
GAAGAAGATGTTGGACCTGAAAATGTAAATTTTGATTAAAACTTTTGA


>TTHERM_00140790(protein)
MIRLFQCQPIQRNPGASGFSLKITFVTFNPPQNAKFLTLQLSDLLGINFSSITKISYQAV
NNDQFCKLDKTTSINAVFDSTQKKISIPNPFTILDTNSQMPCSGQNVPPNWLTIQIVSTF
QYGGTINIQTFYDSVQYGTTNSIGLSTPLQVQPDNILDANIQFGFSSTTPSKIISDIGEY
SLKVTTPTLTTAINQIALTLPMYWYPDTLLPDSGCQQTSVPQQASFKSTLLSSLSATVTT
DNPNGLYKVALSFTQINLNGQIVDLTFQMTNPFTSANIVLEGTQLIIIAAFNYQQSPSST
VYTAFQTQFSNTNVQASSKTFPDCNQNGNVQILCSPTSNGSYTNQACMSGQTVFVKILMY
PIFFQDIYSSVQFTLSNLPPNQQAITGITMQIQNAGSQADAGVPSNSVSTNNQVIFFNQY
LNGNVNYQSYPFICMAGIYIQWLSIIIPSFQLPYDIDGLNISAQFFVQPFLPLAGYSQYK
RDLVSDKILNTQCSNTKIQINQNTLKAAQVTTSNQNDLQVGATSATHEFTIKSQFSFLST
SGKIQLTLPSSLSINAGGTFSCTLKFILTDNSLLSNPTTCTKAGTPTVVTLSYTYSGTQK
AIGFVFTINQVKNPTIIQFSKFSVQTFLRNGGLSESNDNSNTFGFTTLPAPFTTAQLVNN
APGVKNVYTLSPYKLTLISPVDLLTTNQIIVNFPNYVLEINNISVTSPSTGITTSSNNQF
PLTLTFTQQITANTPINVQFTIRNPPVSNLDYQFQIVAYDVTPDKTFLQSTINYGSTDNI
KLVGFSSFGVISSSPQNLATAVFTVSFNPTVLLAKPSIMILTFTAPTNTHNFLITAQTTC
SPITPGLTLSCTINTPSTNQLTVTFNTDIQPSTNYQFNIQNVLNYLSTSPYQITGDLGYS
QNQVGNESSQTIQNTQFQSLSTVQLVITNSQLGIASQYQFNIQTVSPFPQNGNIVVTATD
LVQFVLPSSVTVNLSTCTGSAGDTTSKLTLSSCYPNQDPSLITMSVNNPNQLIQNSNTPF
TITLNEIVGGTLYPIKQYTSPNLVYKNKCNVSSFCKTCQDANPSSCLTCYPQNTIYYQSQ
NVYVQEIILNSVPAVPNCVASCPAQSYQTTQSGQSICASCSPPCTACMNSSTFCTSCSGN
LYLDPTINTCSANCPNLYFQGSNNKCQLCSTVGNCLTCSSAGVCTSCDPNFYKKQNTQCV
TQCDSSYYLANGGTECKPCPTGCNTCTSDTNCTACSVGYIKYQTTCVSSCPSGYSRLMQG
GVYVCGLCDPNCQACDTISTTCTSCYPNTYLYNQKCITQSQIPAGNFGDNATWTVQPCMN
YCVACSYKSLCTTCSQSAVVYQGVCYTTCPSSAPVPDGAGGCKQAIVPAAVSDNSSKVVP
FPMLLSCIAFCISVYFSKYEKPQTFVPGCIVGFCALFEWISWIILIAICYLNDGIMSITT
IAAAVGFVLIYLFNLVYYILYRKTISKDTSFMEWELSHKNRMCKNVSIFFSCLISFKIQK
IIFCKYFNQNFFKAKLKDIDLLSPFNKVSVLSVIFNSFLIILSAAIFSYKYQNSTQIYIL
SLDTLLVTIFMIIFMIWEALKNETFFEENYNMNFEQMSQFTQRFFPFDQSYMERARQRSV
YGHLKKSESNSSLTEFGKDNKVTKVEQLQQPYSQVMDPNDISTNAAIDRNVLNNSNNGAP
YLIQDELSESSKPGKKRQFEKKHVAPVFDHKNFPPIEENSLEDEDEDYYDEDYQNQTMKK
MVGASNMAGLANSKGFDKNKMISLDDQEDLENQRNKNLNNSNQFQNSNGFNKNNGSDQVP
SQLNQSHTVYYDPQDPSGQMMNNVSMGVGLQEDENDGEGEEVRQRLFSKQSGDENMKEKA
ALIAGTSLIGGAVVGAAAAQSANNKNEQQQLVDQNGNRIDKDGNLIDKDGNKIDKEGNRI
DKNGNKIDKDGNMIDKDGYIIDKEGNKIDKDGNKIDKDGNKIDKDGNKIDKDGNRIDKDG
NKIDKDGNRIDKDGNRIDKDGNRIDKDGNRIDKDGHRIDKDGNRIDKDGNRIDKDGNKID
KNGNRIDKDGNRIDKDGNIIDKDGNRIDKDGNRIDKDGNRIDKDGNRIDKDGNRIDKDGN
RIDKDGHRIDKDGNKIDKDGNRIDKDGNRIDKDGNRIDKDGNRIDKDGNRIDKDGNRIDK
DGNRIDKNGNRIDKDGNRIDKDGNRIDKNGNRIDKDGNRIDKDGNRIDKDGNRIDKDGNR
IDKDGNRIDKDGNKIDKDGNRIDKDGNRIDKDGNRIDKDGNRIDKDGNRIDKDGNRIDKD
GHRIDKDGNRIDKDGNRIDKDGNRIDKDGNRIDKDGNRIDKNGNKLDKNGKVLDDKNKKA
EDDMLFYFNNPLNDQNEQNKNNQKEGQQDKTKKAQNLDENKVEKIMPEVEDLDEDLSKKD
KNQNEMGKNKKMITPNDIVKGNNKNQKGPQKNNLFGTSDDEGANQNSKKKKGQSEKKNNI
YDSDESLHTASEAEMNFNEISPTDFNILNQRYEEDYFVQPPQSALQMQLLQQSLSQLNRN
ISSSQSQAFMNNTGFDGNNTRQSQPQAGQFTTGVGNSQGFDKKMVNQFGQNNIDGSSKLQ
QNQQKQKTLQPSNSNLSMNSQNPQNGMNKSNSPVKRQKQVGLNNSRSQNVNALSVDIKQN
TQPNIQGQSNNLSTINSNNNGNINPILANPNANGNTTDQLLIENFDDFNNNTSSQTAIPQ
GFYQNQFNSSFNNQDPRMSYTQMNRGNLSSRSKGNSPSSQNIAYKVPAVDVNKLKNLEKI
YLQRIEANVNSSQSSRKNALKKKKKKIQRELSHTSNLQVNPTQGMKSPGDMSEIYFGERG
QKFDPTMLDHNGEEVIDFDDEEDVGPENVNFDQNF


>TTHERM_00140790(gene)
ATGATAAGATTATTTTAGTGTTAGCCAATTTAAAGAAATCCAGGAGCTTCAGGATTTAGT
TTAAAAATTACATTTGTGACATTTAATCCTCCATAAAATGCTAAATTCTTAACACTACAA
CTAAGTGATTTGTTGGGTATAAATTTTAGTAGTATCACAAAAATTTCATACTAAGCTGTA
AATAACGATTAATTTTGTAAACTTGACAAAACCACTTCAATAAATGCTGTATTTGATTCC
ACCCAAAAAAAAATTTCAATTCCAAATCCTTTCACAATATTAGATACTAATTCTTAAATG
CCATGTAGTGGATAAAATGTACCTCCAAATTGGTTAACTATACAAATAGTAAGTACCTTT
TAATATGGAGGAACAATAAATATTTAAACGTTTTATGACTCTGTATAATATGGCACAACT
AATTCTATTGGCCTTTCTACACCATTATAAGTATAACCAGATAATATTTTAGGTAAAAAT
AAATTAAATATTATTATATGCAAACTCTTTTTATATAATTTAATTAATATAAATAACAAC
ACAACATAAAAATTCTTCTTTTTTGAATGAAGCTTCAAGGCTTAACACTTAAAAATAATT
TTTTATTTTATTAAAAGATGCAAATATATAGTTTGGTTTCTCATCAACTACTCCATCGAA
AATTATATCTGATATAGGTGAATACAGTTTAAAAGTGACAACTCCGACTCTCACTACAGC
AATAAATTAAATTGCTTTAACTCTTCCAATGTATTGGTATCCTGATACTCTTTTACCTGA
TAGTGGCTGCTAGCAAACATCAGTACCATAATAAGCAAGCTTCAAATCTACATTACTAAG
TTCATTATCAGCAACTGTTACTACTGATAATCCAAATGGTTTGTACAAAGTTGCATTAAG
TTTCACATAAATAAATCTAAATGGTTAAATAGTTGATTTAACTTTTTAAATGACAAATCC
ATTTACATCCGCTAATATAGTATTAGAAGGAACCTAATTGATAATTATAGCAGCTTTTAA
TTATTAGTAGAGTCCTAGTTCAACTGTGTATACTGCCTTTTAAACATAATTTTCAAATAC
TAACGTGTAAGCATCATCTAAGACATTTCCAGATTGTAATTAAAACGGAAATGTATAAAT
ACTATGCTCTCCTACAAGTAATGGAAGCTATACTAATTAAGCATGCATGTCAGGTTAGAC
TGTATTTGTAAAAATATTGATGTATCCTATTTTTTTTTAAGATATATACTCCTCTGTGTA
ATTTACTTTATCTAATCTTCCACCCAATTAGCAAGCTATAACTGGTATTACGATGCAAAT
TTAAAATGCTGGGTCACAAGCAGATGCTGGGGTACCATCGAATTCTGTTAGTACCAACAA
TTAAGTGATATTTTTTAATCAATATTTAAATGGTAATGTAAATTATTAATCCTATCCATT
TATTTGCATGGCTGGCATATACATACAATGGTTATCTATTATTATACCATCATTTTAACT
TCCTTATGATATAGATGGACTTAACATATCTGCATAATTCTTTGTTTAACCCTTTTTACC
ATTAGCAGGCTATAGTTAGTATAAAAGGGATCTCGTTGTAATTTATTTATTTTTAATTTT
TAAAGCTCAAATTAAAATATTTTTTATATCAATTTTTAGTCTGACAAAATCTTGAATACT
TAATGCAGTAACACTAAAATATAAATAAATTAAAATACTCTTAAAGCTGCTTAAGTAACA
ACTTCTAATTAAAATGACTTACAGGTAGGTGCAACTTCAGCAACTCACGAATTTACAATT
AAAAGCTAATTTTCATTTCTTTCTACATCCGGAAAAATTTAACTTACTCTTCCCTCATCT
TTATCAATAAATGCTGGTGGAAGTATATTAATAATTTTTTTTTAATTAGTAAACATAATT
TAATTTTTAATTTAATAGCCTTTTCTTGTACTTTAAAATTTATTCTTACTGATAATTCAC
TGCTTTCTAATCCCACTACATGCACAAAAGCTGGTACACCTACTGTTGTTACCTTGTCAT
ATACATATTCTGGAACTTAAAAGGCTATTGGATTTGTTTTTACTATAAATCAAGTGAAAA
ACCCAACAATAATATAATTTTCAAAGTTTTCAGTTTAAACATTCTTGAGAAATGGTGGTC
TTTCTGAGTCTAATGATAATTCAAATACTTTTGGGTTTACCACTCTACCTGCTCCTTTTA
CTACAGCCTAGCTAGTAAATAATGCTCCAGGAGTAAAGAATGTTTACACGCTTTCTCCTT
ACAAACTTACACTTATCTCACCAGTTGATTTGCTAACCACTAACTAAATTATTGTTAATT
TTCCAAATTATGTTTTAGAAATAAATAATATATCTGTTACTAGTCCTTCAACTGGTATCA
CTACTTCATCAAATAATTAATTTCCATTAACATTGACATTTACTCAATAAATTACTGCTA
ATACTCCAATTAATGTGCAGTTTACTATAAGAAATCCACCAGTTTCAAATTTAGACTACT
AATTTTAAGTATCATTATTATTTCATTTTTATGATAATATTCTTTAATAATTAATATATT
ACATTTAGATTGTTGCATATGATGTTACACCAGATAAAACTTTTTTATAAAGCACTATTA
ACTATGGTAGTACAGATAATATTAAATTAGTAGGTTTTTCATCTTTTGGGGTAATTTCAA
GTAGTCCTTAAAATTTAGCAACAGCTGTGTTTACAGTATCTTTCAATCCTACTGTACTAC
TTGCCAAACCGTCTATAATGATTTTAACTTTTACAGCACCAACTAATACTCATAATTTTC
TAATAACTGCATAAACAACTTGCTCACCTATCACACCAGGGCTTACTCTAAGCTGCACTA
TTAATACACCTTCAACTAATTAGTTGGTATCTCTAAATAGAATGATTTCAAAAATAAATT
AACAAAATATTTTTATAAATATAATAGACAGTTACTTTCAATACCGATATATAGCCATCT
ACAAACTATCAATTTAATATTTAAAATGTTTTAAATTATTTGAGTACATCTCCATACCAA
ATAACAGGAGATCTTGGGTACTCATAAAATTAGGTTGGAAATGAATCATCTTAGACTATT
TAAAATACATAATTTTAGAGCTTATCTACAGTATAATTGGTGATTACAAACAGCTAACTA
GGAATTGCAAGTTAATATTAATTTAATATCTAAACAGTATCTCCTTTCCCATAAAATGGT
AATATAGTTGTAACAGCAACTGATCTAGTATAATTTGTACTGCCTTCTAGTGTAACTGTA
AATTTATCTACTTGTACAGGGTCAGCGGGTGATACTACATCTAAATTAACTTTATCTTCT
TGCTATCCAAATTAAGACCCATCCTTGATTACAATGTCTGTTAATAATCCTAACTAATTA
ATTCAGAACTCAAATACTCCATTCACTATAACTCTCAATGAAATAGTTGGCGGAACGCTT
TATCCAATTAAATAATACACTTCTCCTAATCTCGTATACAAGAATAAATGTAATGTATCA
TCATTTTGTAAAACTTGCTAAGATGCCAATCCTTCAAGCTGCTTAACTTGCTATCCTCAA
AATACTATTTATTATTAATCTTAAAATGTATATGTTTAAGAAATAATTTTAAATAGTGTA
CCTGCTGTTCCAAATTGTGTGGCTAGCTGTCCAGCATAGTCTTACTAAACTACTCAAAGT
GGATAAAGTATATGCGCATCATGCAGCCCGTATTCGATATTTAAAAAATAAATTAAATAT
TTAATATTTTTAACAATTAATTAGGCCATGCACAGCTTGTATGAATTCATCTACTTTTTG
CACTTCCTGCTCAGGCAATCTTTACTTAGATCCAACAATAAACACTTGCAGCGCAAATTG
TCCTAATCTATATTTCTGTAATAAAAAAAAAATATTTTTTTAAATATTAATTGAATAACA
CAGATAAAAGTTTTTAAAACTGATAAATAACAACAATAATTGAATAAAATATAAATATTT
TTGCTTTCATTGATCATTTTTTCAAAAAATATTTAAAAAATTTACTATAAAATAAAATAA
GATAAAAAAATAAAAGATATTCAATAAAAAGGGCATTTTTGAAATGTTTTTTAAAATATT
TTTTTTATTTATTTAATTTTTAGAGGGATCTAACAATAAATGTTAACTTTGCTCAACTGT
AGGAAATTGTTTAACTTGTTCTTCTGCTGGTGTATGCACTTCATGCGATCCCAACTTTTA
TAAAAAATAAAATACATAATGTGTAACCTAATGTGATAGCTCGTAACTCTTTAAAAAATT
TATTTACAGAAGTATATTAAAAATTATTTTTAATAATTAGATATTACCTAGCTAATGGAG
GAACAGAATGTAAACCTTGCCCCACAGGATGCAATACTTGTACTTCTGATACAAACTGTA
CCGCTTGCTCTGTTGGATATATTAAATATTAAACAACATGTGTTTCAAGCTGCCCTTCAG
GATATTCAAGGCTTATGCAAGGCGGAGTATATGTTTGTGGTCTATGTGATCCAAATTGCT
AAGCTTGTGATACCATAAGCACTACTTGTACTTCTTGTTACCCTAACACATATTTGTATA
ACTAAAAATGTATTACATAATCTTAAATACCTGCTGGTAACTTTGGAGACAATGCAACAT
GGACAGTCTAACCTTGCATGAATTATTGTGTTGCATGTTCTTATAAATCACTGTGTACTA
CATGCTCTTAATCAGCAGTTGTTTATTAAGTAAATTTACTAATTTTTAAAAACTAAAAAA
AATAATTTATTTGTTTAAATTTAGGGTGTCTGTTACACTACTTGTCCTAGTAGTGCTCCT
GTACCAGACGGAGCTGGTGGTTGTAAATAGGCAATTGTGCCGGCAGCAGTATCAGATAAT
AGCTCTAAAGTAGTACCCTTCCCTATGCTTTTGTCATGCATAGCATTCTGCATATCTGTA
TACTTCTCTAAATATGAAAAACCTCAAACATTTGTTCCTGGTTGCATTGTGGGTTTTTGT
GCTCTCTTTGAATGGATATCTTGGATAATATTGATAGCGATATGCTATTTAAATGATGGA
ATTATGTCAATAACTACAATTGCTGCTGCCGTAGGATTCGTCCTTATTTACCTATTTAAT
TTAGTTTATTACATATTATACAGAAAAACAATATCTAAAGATACCTCATTTATGGAGTGG
GAATTATCTCATAAAAATAGGATGTGTAAAAATGTATCAATATTTTTTTCATGCCTCATT
TCCTTCAAAATTTAAAAAATTATCTTCTGCAAGTATTTTAACTAAAACTTTTTTAAGGTA
AATTTTATTTTGTAAAAATAAATATTCAAATTGCTTTTTAAATTAAGGCAAAACTTAAAG
ATATTGACTTATTATCTCCTTTCAATAAAGTTTCTGTGCTAAGTGTTATATTTAATAGCT
TCTTAATTATTTTAAGTGCAGCCATATTTAGCTATAAATATCAAAATTCCACTTAGATTT
ATATTTTAAGTCTAGATACATTGCTTGTGACCATTTTTATGATTATTTTCATGATTTGGG
AGGCATTGAAGAATGAAACCTTCTTTGAAGAAAACTACAATATGAATTTTGAACAAATGA
GCTAATTTACTCAACGATTCTTCCCCTTCGACTAATCTTACATGGAGAGGGCAAGGTAAA
GATCAGTTTATGGACATCTTAAAAAATCAGAGTCAAATTCTAGTCTTACCGAATTTGGCA
AGGATAACAAAGTGACTAAAGTAGAACAATTACAGTAACCTTACAGTTAAGTAATGGACC
CAAATGATATTTCAACAAATGCCGCTATAGATAGAAATGTATTAAATAACTCTAATAATG
GAGCACCTTATCTTATTCAGGATGAGTTATCAGAGTCCTCTAAACCTGGAAAAAAGAGAT
AATTTGAGAAAAAGCATGTTGCTCCTGTATTTGACCATAAAAGTAAATTTTATTTAAAAA
ATACTGTTTTAAGATTTATTTTTTTTTAAAGATTTCCCACCTATAGAAGAAAACTCATTA
GAAGATGAGGATGAAGATTATTATGATGAAGATTATTAGAATCAAACTATGAAAAAAATG
GTTGGGGCCTCTAATATGGCAGGTTTAGCAAATTCAAAAGGCTTTGATAAAAATAAAATG
ATATCTCTGGATGATTAAGAAGATTTAGAAAATTAAAGAAACAAAAATTTAAATAATTCA
AACTAATTTTAAAACAGTAACGGCTTCAACAAAAATAATGGTAGTGATTAAGTCCCCTCA
TAGTTAAATTAAAGTCACACAGTTTACTATGATCCTTAAGATCCTTCAGGATAAATGATG
AACAATGTAAGTATGGGAGTAGGATTGCAAGAAGATGAAAATGATGGAGAAGGAGAAGAG
GTACGCTAACGATTATTTTCTAAATAGTCTGGTGATGAAAATATGAAAGAAAAAGCAGCT
TTGATTGCAGGTACTTCTTTAATTGGAGGAGCAGTAGTAGGTGCTGCAGCTGCCTAAAGT
GCAAATAATAAGAATGAATAATAGTAATTAGTTGACTAAAATGGAAATAGGATAGATAAA
GATGGCAATCTTATAGACAAAGATGGTAATAAAATTGATAAAGAAGGCAATAGAATTGAC
AAAAACGGTAATAAGATTGATAAAGATGGAAATATGATTGATAAAGATGGTTATATAATT
GATAAAGAGGGGAATAAGATTGATAAAGATGGAAATAAGATTGATAAAGATGGAAATAAG
ATTGATAAAGATGGAAATAAGATTGATAAAGATGGAAATAGAATTGATAAAGATGGAAAT
AAAATAGACAAAGATGGTAATAGGATCGATAAAGATGGTAACAGAATTGATAAAGACGGT
AATAGAATTGATAAAGATGGTAATAGGATTGATAAAGACGGACATAGAATCGATAAAGAT
GGAAATAGAATTGACAAAGACGGGAATAGAATTGATAAAGATGGAAATAAGATTGATAAA
AATGGTAATAGAATTGACAAAGATGGGAATAGAATTGATAAAGATGGTAATATAATTGAT
AAAGATGGTAACAGAATCGATAAAGATGGAAATAGAATTGACAAAGATGGAAATAGAATT
GACAAAGATGGAAATAGAATTGACAAAGATGGAAATAGAATTGACAAAGACGGCAATAGG
ATTGATAAAGATGGACATAGAATTGATAAAGATGGAAATAAAATTGATAAAGATGGTAAT
AGAATTGACAAAGACGGCAATAGGATTGATAAAGATGGAAATAGAATTGACAAAGACGGG
AATAGAATTGATAAAGATGGTAATAGAATTGATAAAGATGGAAATAGGATTGATAAAGAT
GGTAATAGAATTGACAAAAATGGTAACAGAATTGATAAAGATGGTAATAGAATTGACAAA
GACGGTAATAGGATTGATAAAAATGGTAATAGAATTGACAAAGATGGGAATAGAATTGAT
AAAGATGGTAATAGAATTGATAAAGATGGTAACAGAATCGATAAAGATGGAAATAGAATT
GACAAAGATGGTAACAGAATTGATAAAGATGGAAATAAAATTGACAAAGATGGTAACAGA
ATTGATAAAGATGGTAATAGAATTGACAAAGACGGCAATAGGATAGATAAAGATGGAAAT
AGAATTGACAAAGATGGCAATAGAATTGACAAAGACGGCAATAGGATTGATAAAGATGGA
CATAGAATTGATAAAGATGGAAATAGAATTGACAAAGATGGTAACAGAATTGATAAAGAT
GGTAATAGAATTGACAAAGACGGTAATAGGATTGATAAAGATGGTAACAGAATTGATAAA
AATGGAAATAAATTAGATAAAAATGGAAAGGTTTTAGATGATAAAAACAAAAAGGTAAAG
AATAAGAACTATTTTTATAAAAATGATTTTTTAATTTTAAATAATAAATAAATATTAATA
CAAGGCTGAAGATGACATGTTGTTTTATTTTAATAATCCTCTTAACGACTAAAATGAATA
AAATAAAAACAACCAAAAGGAAGGATAATAGGATAAGACAAAAAAAGTATGAATTTTAAA
AAATTACATTAAAAATTATGATAAATTATTTTATTATTTATTTGAATTGAATAGGCTTAA
AATTTAGATGAAAATAAGGTAGAGAAAATTATGCCAGAAGTCGAAGATTTGGATGAGGAT
TTATCTAAAAAAGATAAAAACTAAAATGAAATGGGTAAAAATAAGAAAATGATAACTCCT
AATGATATTGTAAAAGGAAACAATAAGAATCAGAAAGGTCCATAAAAGAACAATTTGTTT
GGTACTTCAGATGATGAAGGAGCTAATCAAAATTCAAAAAAGAAAAAAGGACAATCTGAA
AAAAAGAACAATGTAATAGATATTGTTTAAATTATATTTATGTTAACTAATTTATTGATT
TAACATAGATTTATGATTCTGATGAAAGTTTGCACACAGCTAGTGAGGCGGAAATGAATT
TCAATGAAATTAGTCCAACAGACTTCAATATACTTAACTAAAGATATGAAGAAGACTATT
TTGTTTAACCACCTTAAAGTGCACTTTAAATGTAACTTCTCTAATAAAGCTTGAGTTAAC
TAAATAGAAATATTTCTAGCAGCCAAAGTTAAGCCTTTATGAATAATACTGGGTTCGATG
GAAATAATACAAGGTAATCATAACCATAGGCAGGATAGTTCACAACTGGAGTTGGAAATA
GCTAAGGATTTGATAAAAAGATGGTGAATTAATTTGGTTAGAACAATATTGATGGCTCAA
GCAAATTATAACAAAATTAATAAAAGTAAAAGACTTTACAGCCAAGTAACTCGAATTTAT
CTATGAACAGTTAAAATCCATAAAATGGTATGAACAAATCAAATAGTCCAGTGAAAAGGT
AAAAGCAGGTTGGACTTAATAACTCACGCTCTTAAAATGTTAATGCTCTCTCAGTAGACA
TAAAGCAAAATACTTAGCCTAACATTTAAGGATAGAGCAATAATCTAAGTACAATCAACT
CAAATAATAATGGAAATATTAATCCTATATTAGCTAATCCTAATGCAAATGGCAATACAA
CAGACTAACTCTTAATAGAAAACTTCGATGATTTTAATAATAACACTTCTTCTTAAACTG
CTATACCTTAAGGTTTTTACCAAAATCAATTTAATTCAAGTTTTAACAATTAAGATCCTC
GAATGAGCTACACTTAAATGAATAGAGGCAATCTAAGTAGTAGGTCTAAAGGTAATTCAC
CTTCAAGTTAGAATATAGCTTACAAAGTTCCTGCTGTTGACGTAAACAAATTAAAGAATT
TAGAAAAGATATATCTTCAAAGAATAGAAGCTAATGTTAATTCCTCATAAAGCTCTAGAA
AGAATGCCTTGAAAAAGAAAAAAAAGAAAATCTAGAGAGAATTATCACACACGTCTAATC
TTTAAGTAAATCCAACTTAAGGAATGAAATCTCCTGGAGACATGTCTGAAATTTATTTTG
GAGAAAGAGGTTAGAAATTTGACCCTACAATGTTAGACCATAATGGAGAAGAAGTTATTG
ATTTTGATGATGAAGAAGATGTTGGACCTGAAAATGTAAATTTTGATTAAAACTTTTGA