Identifiers and Description

Gene Model Identifier

TTHERM_00137610

Standard Name

None

Aliases

PreTt24387 | 10.m00436 | 3698.m00154

Description

SNF2 family N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF09110 ) HAND
  • ( PF09111 ) SLIDE
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( TIGR00034 ) 3-deoxy-7-phosphoheptulonate synthase
  • ( PF04851 ) type III restriction enzyme, res
  • ( PF08597 ) Translation initiation factor eIF3 subunit
  • ( PF05979 ) Bacterial protein of unknown function

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00137610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_64350
WormBaseWBGene000021699.997093137033517e-262locus:isw-1 Chromatin-remode
ling complex ATPase chain isw-
1 status:Confirmed UniProt
:P41877 protein_id:CCD70709.
1
Tetrahymena borealisEI9_05826.19.997093137033517e-262SNF2 family domain-containing
protein (1225 aa)
DictyBaseDDB_G02929489.997093137033517e-262isw on chromosome: 6 position
2254360 to 2258387
OxytrichaContig16241.0.g1029.997093137033517e-262SNF2 family N-terminal domain
SGDYOR304W9.997093137033517e-262ISW2 ATP-dependent DNA translo
case involved in chromatin rem
odeling; ATPase component that
, with Itc1p, forms a complex
required for repression of a-s
pecific genes, INO1, and early
meiotic genes during mitotic
growth

General Information

Paragraph NoGene NameParagraph Text
126TTHERM_00137610This protein is homologous to proteins that contain helicase and SANT domains, which are associated with transcription. It contains three domains; the first two domains (score=22.832, 18.839), in the helicase family, indicates that the protein’s function, which involves the binding of ATP, could be related to the separation of double-stranded nucleic acids. The third domain (score=10.421) belongs to the SANT domain, which indicates that the protein is involved in chromatin-remodeling or transcription regulation via protein-protein interactions. The closest homologs are in Ichthyophthirius multifiliis, with 77% identical residues and Pseudocohnilembus persalinus,with 54% identical residues. It is possible that this protein is an enzyme with helicase activity that functions to remodel chromatin or regulate transcription. Paragraph by: Madison Seto, Keck Science Department, Scripps College

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00137610(coding)
ATGGCTGATGAAACTAACGAAAAATCCAGAGGATTTGAGGATGTCATGGATGAAGAAGAT
GATGTCCATGAAGTAGAAAAAATATAGGGTAGGAAGAGTTAGCAATAAAAATATCTGAAA
TAAATAAGCAACGACGATGAAAATCCATAGCAAGAGGAGATAAGCGATGTTGAGAAGAAA
ATGAAAACTCTTCTGCTGAAAGCTGAATAATATGCAAGTTTTTTAGTTTCAAGACATTAA
TAGAAAAAGAATAAAAAGCAAGTTGTTCAAAAAAGAAGAGGGTAATATTAGGAAGAGAAA
GAAGAAGAAGAGTAGCTTATTAAAGAGGAAGAAGAAGAGGATGATAACTTGCCTACCATA
CTAACAAGCTAGCCAAAAATATTAAAGGGAGGAAAATTAAAAGATTATCAAATGATTGGT
CTTAATTGGATGATCAGTTTATATGAAACTGGTTTAAATGGTATATTAGCCGATGATATG
GGTCTTGGTAAAACAATTTAATCTATCTCTTTAATAGGTTTCCTGAAAGAATTTAAAAAA
ATAAATGGTCCACATTTAATTATAGCTCCTAAGAGTACTTTAGGTAATTGGTTTAACGAA
TTTCAGAAATGGTTGCCTTGCTGCAGAACAATCAAATTAATTGCAACAAAAGATGAAAGA
GAAGAAATTTTGTAAAATTATATCGCTAATAGCAAATTTGATGTTTGTTTAACAAGTTTT
GAAGGAGCAAAGCTTTGCTAAAAATATTTGAAAAAAATAAATTTCTAATATATTATTATT
GATGAAGCTCACAAGATTAAAAACGAAGAGAGTTAAACTGCTTTGATTTTAAGAATGTTT
AAAACTAATTATAAAATATTGCTCACTGGTACTCCCCTCTAAAACAACCTTCACGAATTG
TGGAGTTTGCTCAACTTTTTATTGCCAGATTTATTCAGCTCAAGTGAGATTTTTGATGAA
TGGTTCAGTGCTAACAATTTGAGTGGCAAAAATAATAACGAAGAAAATGACACAAAGAAT
ATTGAAATGATATCTCAGCTTCATAGAATTTTGAAACCATTTATGATGCGTAGAACTAAA
TCTGAAGTTATGCAAACACTTCCTCCTAAAAAGGAAATCCATTTATATGTAGGTTTGACT
GAATCACAATTAAATATATATAGAAATCTCCTATCTCCTAAGAAAAGTATAACAGGATCT
GAGGATGATAAGAAATTCTATCTTAATATCTTAATGCAACTTAGAAAAGTTTGCAATCAT
CCTTATTTGTTTGAAGGAATAGAAGAAGAAGGGCTCCCACCTCTAGGTGAGCACATTATT
ACTAATTGTGGTAAAATGATGGTCTTAGATAAATTGTTACAAAAACTAAAAAATGGAAAG
CATTAAGTGCTTATTTTCTCTTAAATGACTATGGTTTTAGATATATTAGAGGATTATTGT
AACTACAGACAGTTTAAATATTGCCGTATCGACGGTAATACAGATATGACTGATAGAGAT
AATTAAATTAGTGATTTTGTAAAAGAAGACTCAACTAAATATATTTTCCTTTTGAGTACA
AGAGCAGGTGGTTTAGGTATCAACTTAGCTACAGCAGATACAGTTGTTTTATATGATTCT
GATTGGAATCCATAAATGGATTTATAGGCCATGGACAGAGCTCACAGAATAGGTTAAAAG
AATATCGTTAACGTTTATAGATTAATATCTGAAAATACAATTGAAGAAAAAATTATCGAA
AGATAAACAATTAAATTAAAATGGGATCAATTGATTATTCAGTAGGGTAGACTTGCTTAA
AAGAATCGTGTTCTCTCAAGAGACGAAATTAAGGATATGATTTAATTTGGAGCTTCTGCT
ATTTTCAAATCCAAAGGGGGAACATACACAGATGAGGATATTGACATTCTTCTGTAGAGA
GGTGAGTAAAAAACCAAAGACCATAATAAAACCATTGATGAAAAATTCAAGAAATCTAAT
GAATAAGTGGGAGAATTATCTCTTAGCTCTATCAATATTTATGATTTCTTGTAAAAGAAC
CACGATAATGACAAAACAAAAGAAGATAAAGAAGCCTTAGATGAATAGTTAGCCCGTGAG
TTAGCTAGTGAATTAAGATCTCGTAGAGAAAAGAAGACTATGAATTACAATATCAATGCA
TAGTTTTCACATATGATGGCAACTGCTCCTATGCCTAAGGCTGCTAAAATAATTAAATTA
CCAGAACATTAATTGTTTGTAGAAAGAGAAAAACTTTAAGAATTACTTCAAAAGGAAGAA
GATTTTAAATGCATGAGCAACAGAGCTAAAAAAGCTGAAAAAGAGGAAGAAAATTCAATT
GAAGAAAATGGGCTTACTCCCAAAGAAAACAAACTAAAGGATTAATATTGGGCTACAGGT
TTTCCTACTTGGTTGAAACAAGAATATCTCAGTTTCATTCAAGGATGTGAAAGATTTGGA
AAGACTGCCTACAAAGAAATAGCTGAGCACATCAAGACAAAAACAGAAGAAGAAGTTAGC
TAATATAGCAAAGCCTTTTGGGAAAGAATCGACACAATCAGTGAAAAAGATAAAATCATT
AAGAACATTGAAAGAGGAGAGTAAATTCTTAAGTAGAAATTAGTGATGTCAGACTTATTA
AAAGAGAGATGCAAAATTTATCAAAATGTTAAAGAAGAGTTTGAATTCAATTCAGCCATT
TACAATAAATCTAAATCTAAATTCTACACAACTGAAAATGATAAATTTTTAATTTATGCT
AGTTATCAAATGGGGTACTGCAATTGGCCTGTCATCATAAAAGAAATAAAAACTAATCCT
ATGTTTTAATTTGATCACTTTTTCAAAAGCAGAAGTGAATACGAGTTAAATAAAAGACTT
TAGAGTCTATTAAAAGTAGTAGAAAAGGAGAAAGATTTTATTGTTTAAATTGAAGCTAAA
AAGCTAAAATTAAAGTAAGAGTAGGAAGAGAAGTAAAGAGAGCAAGAACTCAAAAAGGAA
TAATAGAAATAGTAACAATAATTACTCGAATAGTAAAAGGCTGAAAAAGAAAAAGCTAAT
CAACAATAACAACAACAACAGTAATAATAATAATTGAATACAGAAATTATAGTTACAGAT
AGCTAGCCAAAGCCATAATAAAATAGCAACAATAACAAAGATAGTAAAAATATAAATTCT
GCTAAAAATAGCTAAGAATCTTAAGCTAAATAATAAAGTACTATCTAAAAGTCTAGTAAT
TAACAATCTAACTAAGTCCAACAAACTTAAAAAATTAAAGATCCACAAAACTCTTCTTCT
TCTAAAAATAATAATACTAATAGTAAAACAAATGGCTTAAAATAAAATTCTCTATTAAAT
TATGGTGTAAAAGTAGATAAAAAAGTATAACAAGCACCTATTTTGATAGACTTAGAATCA
GAAGATGAAGAAGATGATAAAATAAAAATTAAAAGATTACCAAATGTAATTGTGCCAGAG
CCTTTATCATAAGAAAGTAAGCAAGAAACCTAATAGAAGTAATCATAGTAATCTTCACAA
TCAAGTAATAAATAAAGCACTAGCAATGCATCAAATAATATAAATTCTAAAAAATCTCAC
AATGTTAAAGACGATAAAATAGAATAAAATCCTTAAAAAAAGTTAAAGCGTGATTGA


>TTHERM_00137610(protein)
MADETNEKSRGFEDVMDEEDDVHEVEKIQGRKSQQQKYLKQISNDDENPQQEEISDVEKK
MKTLLLKAEQYASFLVSRHQQKKNKKQVVQKRRGQYQEEKEEEEQLIKEEEEEDDNLPTI
LTSQPKILKGGKLKDYQMIGLNWMISLYETGLNGILADDMGLGKTIQSISLIGFLKEFKK
INGPHLIIAPKSTLGNWFNEFQKWLPCCRTIKLIATKDEREEILQNYIANSKFDVCLTSF
EGAKLCQKYLKKINFQYIIIDEAHKIKNEESQTALILRMFKTNYKILLTGTPLQNNLHEL
WSLLNFLLPDLFSSSEIFDEWFSANNLSGKNNNEENDTKNIEMISQLHRILKPFMMRRTK
SEVMQTLPPKKEIHLYVGLTESQLNIYRNLLSPKKSITGSEDDKKFYLNILMQLRKVCNH
PYLFEGIEEEGLPPLGEHIITNCGKMMVLDKLLQKLKNGKHQVLIFSQMTMVLDILEDYC
NYRQFKYCRIDGNTDMTDRDNQISDFVKEDSTKYIFLLSTRAGGLGINLATADTVVLYDS
DWNPQMDLQAMDRAHRIGQKNIVNVYRLISENTIEEKIIERQTIKLKWDQLIIQQGRLAQ
KNRVLSRDEIKDMIQFGASAIFKSKGGTYTDEDIDILLQRGEQKTKDHNKTIDEKFKKSN
EQVGELSLSSINIYDFLQKNHDNDKTKEDKEALDEQLARELASELRSRREKKTMNYNINA
QFSHMMATAPMPKAAKIIKLPEHQLFVEREKLQELLQKEEDFKCMSNRAKKAEKEEENSI
EENGLTPKENKLKDQYWATGFPTWLKQEYLSFIQGCERFGKTAYKEIAEHIKTKTEEEVS
QYSKAFWERIDTISEKDKIIKNIERGEQILKQKLVMSDLLKERCKIYQNVKEEFEFNSAI
YNKSKSKFYTTENDKFLIYASYQMGYCNWPVIIKEIKTNPMFQFDHFFKSRSEYELNKRL
QSLLKVVEKEKDFIVQIEAKKLKLKQEQEEKQREQELKKEQQKQQQQLLEQQKAEKEKAN
QQQQQQQQQQQLNTEIIVTDSQPKPQQNSNNNKDSKNINSAKNSQESQAKQQSTIQKSSN
QQSNQVQQTQKIKDPQNSSSSKNNNTNSKTNGLKQNSLLNYGVKVDKKVQQAPILIDLES
EDEEDDKIKIKRLPNVIVPEPLSQESKQETQQKQSQQSSQSSNKQSTSNASNNINSKKSH
NVKDDKIEQNPQKKLKRD


>TTHERM_00137610(gene)
ATGGCTGATGAAACTAACGAAAAATCCAGAGGATTTGAGGATGTCATGGATGAAGAAGAT
GATGTCCATGAAGTAGAAAAAATATAGGGTAGGAAGAGTTAGCAATAAAAATATCTGAAA
TAAATAAGCAACGACGATGAAAATCCATAGCAAGAGGAGGTAACAATCAATTAACGATAT
ATTTTAAAAAAAGAAATGTGAGAGAAAGTCATATTTTTGAATAAAAAATTATTTTTTTAA
TAAATTTAGATAAGCGATGTTGAGAAGAAAATGAAAACTCTTCTGCTGAAAGCTGAATAA
TATGCAAGTTTTTTAGTTTCAAGACATTAATAGAAAAAGTAAATATAAACAAATATTTTA
AAAATGCTTTATAAAAGCTTAGCAATTATCAAAATATTTTAAGTATTTCACAAAAATAAA
ATGAGTAATTTCATCATTATAAAATATTTTTAGGAATAAAAAGCAAGTTGTTCAAAAAAG
AAGAGGGTAATATTAGGAAGAGAAAGAAGAAGAAGAGTAGCTTATTAAAGAGGAAGAAGA
AGAGGATGATAACTTGCCTACCATACTAACAAGCTAGCCAAAAATATTAAAGGGAGGAAA
ATTAAAAGATTATCAAATGATTGGTCTTAATTGGATGATCAGTTTATATGAAACTGGTTT
AAATGGTATATTAGCCGATGATATGGGTCTTGGTAAAACAATTTAATCTATCTCTTTAAT
AGGTTTCCTGAAAGAATTTAAAAAAATAAATGGTAAATATTGACATTGTGTGAAAAAATA
TGCAATTAAAACTATTTAAAATAAAGGTCCACATTTAATTATAGCTCCTAAGAGTACTTT
AGGTAATTGGTTTAACGAATTTCAGAAATGGTTGCCTTGCTGCAGAACAATCAAATTAAT
TGCAACAAAAGATGAAGTAAAAATTTTTAAAAAAGTTAATAATGATACTCAATTTACATT
ATTGTTTATTATAGAGAGAAGAAATTTTGTAAAATTATATCGCTAATAGCAAATTTGATG
TTTGTTTAACAAGTTTTGAAGGAGCAAAGCTTTGCTAAAAATATTTGAAAAAAATAAATT
TCTAATATATTATTATTGATGAAGCTCACAAGATTAAAAACGAAGAGAGTTAAACTGCTT
TGATTTTAAGAAGTATATTTCATTCATTTATAATCTCAAATTTTGATATTAATTATTCTT
ACATTCAAATAGTGTTTAAAACTAATTATAAAATATTGCTCACTGGTACTCCCCTCTAAA
ACAACCTTCACGAATTGTGGAGTTTGCTCAACTTTTTATTGCCAGATTTATTCAGCTCAA
GTGAGATTTTTGATGAATGGTTCAGTGCTAACAATTGTAAGATATTGTTTTAAAATTTAA
ATCAAGCTTATTTATAAATTTCATTTTAGTGAGTGGCAAAAATAATAACGAAGAAAATGA
CACAAAGAATATTGAAATGATATCTCAGCTTCATAGAATTTTGAAACCATTTATGATGCG
TAGAACTAAATCTGAAGTTATGCAAACACTTCCTCCTAAAAAGGAAATCCATTTATATGT
AGGTTTGACTGAATCACAATTAAATATATATAGAAATCTCCTATCTCCTAAGAAAAGTAT
AACAGGATCTGAGGATGATAAGAAATTCTATCTTAATATCTTAATGCAACTTAGAAAAGT
TTGCAATCATCCTTATTTGTTTGAAGGAATAGAAGAAGAAGGGCTCCCACCTCTAGGTGA
GCACATTATTACTAATTGTGGTAAAATGATGTAATTAAAATATTTAATAAATAATTGATT
CCATTTAATCAAAATTTATTTCCTAAATAGGGTCTTAGATAAATTGTTACAAAAACTAAA
AAATGGAAAGCATTAAGTGCTTATTTTCTCTTAAATGACTATGGTTTTAGGTAAATTTTA
ATAAATGTTTAAATTTTAATATCTTTCTTTGTTACTTATGAAAATAATAGATATATTAGA
GGATTATTGTAACTACAGACAGTTTAAATATTGCCGTATCGACGGTAATACAGATATGAC
TGATAGAGATAATTAAATTAGTGATTTTGTAAAAGAAGACTCAACTAAATATATTTTCCT
TTTGAGTACAAGAGCAGGTGGTTTAGGTATCAACTTAGCTACAGCAGATACAGTTGTTTT
ATATGATTCTGATTGGAATCCATAAATGGATTTATAGGGTAAAGATTTTATTTCAAAAAA
ACAAACAAACAATTAATGATTTTTAAATTAAATTAGCCATGGACAGAGCTCACAGAATAG
GTTAAAAGAATATCGTTAACGTTTATAGATTAATATCTGAAAATACAATTGAAGAAAAAA
TTATCGAAAGATAAACAATTAAATTAAAATGGGATCAATTGATTATTCAGTAGGGTAGAC
TTGCTTAAAAGAATCGTGTTCTCTCAAGAGACGAAATTAAGGATATGATTTAATTTGGAG
CTTCTGCTATTTTCAAATCCAAAGGGGGAACATACACAGATGAGGGTAAAAATTATTCCC
AAAGTTAAAGTAAAAATGATAATATAATTAATATTTATAGATATTGACATTCTTCTGTAG
AGAGGTGAGTAAAAAACCAAAGACCATAATAAAACCATTGATGAAAAATTCAAGAAATCT
AATGAATAAGTGGGAGAATTATCTCTTAGCTCTATCAATATTTATGATTTCTTGTAAAAG
AACCACGATAATGACAAAACAAAAGAAGATAAAGTAAAATTACTTTTAAAATGAGATATT
AAATATATTCTGAAATATTTAATAGGAAGCCTTAGATGAATAGTTAGCCCGTGAGTTAGC
TAGTGAATTAAGATCTCGTAGAGAAAAGAAGACTATGAATTACAATATCAATGCATAGTT
TTCACATATGATGGCAACTGCTCCTATGCCTAAGGCTGCTAAAATAATTAAATTACCAGA
ACATTAATTGTTTGTAGAAAGAGAAAAACTTTAAGAATTACTTCAAAAGGAAGAAGATTT
TAAATGCATGAGCAACAGAGCTAAAAAAGCTGAAAAAGAGGAAGAAAATTCAATTGAAGA
AAATGGGCTTACTCCCAAAGAAAACAAACTAAAGGATTAATATTGGGCTACAGGTTTTCC
TACTTGGTTGAAACAAGAATATCTCAGTTTCATTCAAGGATGTGAAAGATTTGGAAAGAC
TGCCTACAAAGAAATAGCTGAGGTAATTTTTTCAAAAGTTGTTGTTGCTATAAAAGTTAA
AATAATTTTATTTTAAACATAAATAGCACATCAAGACAAAAACAGAAGAAGAAGTTAGCT
AATATAGCAAAGCCTTTTGGGAAAGAATCGACACAATCAGTGAAAAAGATAAAATCATTA
AGAACATTGAAAGAGGAGAGTAAATTCTTAAGTAGAAATTAGTGATGTCAGACTTAGTAA
ATAATATTCATTCATTTTATGAGCTTTTTCAAATAAAAATATTTATTTCTTCAAATTTTT
AGTTAAAAGAGAGATGCAAAATTTATCAAAATGTTAAAGAAGAGTTTGAATTCAATTCAG
CCATTTACAATAAATCTAAATCTAAATTCTACACAACTGAAAATGATAAATTTTTAATTT
ATGCTAGTTATCAAATGGGGTACTGCAATTGGCCTGTCATCATAAAAGAAATAAAAACTA
ATCCTATGTTTTAATTTGATCACTTTTTCAAGTAAATTAAAAAAAAATTTTATTTAATTT
AAATATATTTTATTAAACTTACAGAAGCAGAAGTGAATACGAGTTAAATAAAAGACTTTA
GAGTCTATTAAAAGTAGTAGAAAAGGAGAAAGATTTTATTGTTTAAATTGAAGCTAAAAA
GCTAAAATTAAAGTAAGAGTAGGAAGAGAAGTAAAGAGAGCAAGAACTCAAAAAGGAATA
ATAGAAATAGTAACAATAATTACTCGAATAGTAAAAGGCTGAAAAAGAAAAAGCTAATCA
ACAATAACAACAACAACAGTAATAATAATAATTGAATACAGAAATTATAGTTACAGATAG
CTAGCCAAAGCCATAATAAAATAGCAACAATAACAAAGATAGTAAAAATATAAATTCTGC
TAAAAATAGCTAAGAATCTTAAGCTAAATAATAAAGTACTATCTAAAAGTCTAGTAATTA
ACAATCTAACTAAGTCCAACAAACTTAAAAAATTAAAGATCCACAAAACTCTTCTTCTTC
TAAAAATAATAATACTAATAGTAAAACAAATGGCTTAAAATAAAATTCTCTATTAAATTA
TGGTGTAAAAGTAGATAAAAAAGTATAACAAGCACCTATTTTGATAGACTTAGAATCAGA
AGATGAAGAAGATGATAAAATAAAAATTAAAAGATTACCAAATGTAATTGTGCCAGAGCC
TTTATCATAAGAAAGTAAGCAAGAAACCTAATAGAAGTAATCATAGTAATCTTCACAATC
AAGTAATAAATAAAGCACTAGCAATGCATCAAATAATATAAATTCTAAAAAATCTCACAA
TGTTAAAGACGATAAAATAGAATAAAATCCTTAAAAAAAGTTAAAGCGTGATTGA