Identifiers and Description

Gene Model Identifier

TTHERM_00133759

Standard Name

None

Aliases

3698.m01703

Description

cdk10/11; cyclin-dependent kinase-like Serine/Threonine kinase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00133759

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05741.19.997093137033517e-262cdk10/11 (452 aa)
OxytrichaContig17113.0.g221.9998521972819316e-89Protein kinase domain
DictyBaseDDB_G02737212.0008312485874125e-83cdk9-2 on chromosome: 2 positi
on 3321422 to 3323747
WormBaseWBGene000071353.000809166761476e-75locus:cdk-12 Cyclin-dependen
t kinase 12 status:Partially
_confirmed UniProt:P46551
protein_id:CAA84302.3
SGDYKL139W9.996162112727537e-67CTK1 Catalytic (alpha) subunit
of C-terminal domain kinase I
(CTDK-I); phosphorylates both
RNA pol II subunit Rpo21p to
affect transcription and pre-m
RNA 3 end processing, and ribo
somal protein Rps2p to increas
e translational fidelity; simi
lar to the Drosophila dCDK12 a
nd human CDK12 and probably CD
K13
Stentor CoeruleusSteCoe_181978.194012623990515e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00133759(protein)
MSQEDLNDIEEGELEAKDFADDYQYDRVTLDQIRSRDINEDYEVLHEVGSGTYGRVYKAN
RKSVSNKLYALKQLDVSQEKDGFPITALREIKLLQKLDQENVLKINEIVTMRTSKDKGKS
KITTFLVFDYMEHDFQGLIRKKQPFTQPQIKCVMQQLFKGLDYLHNSNVIHRDLKSANLL
LNKDGVLKIGDFGLARQVERPLLRPLTSVVVTLWYRAPEILLGDKNYSFKSDVWSAGCFM
AELLLGEPIFNGKNESTQIEQIYEKCGSPDPDSWAGLTTFKFWKDLQPKKEYSASLISYM
KQKIPTIDSSTLDFLQALLTMNPEERLDSNQALHHEYFEREPLPCPVSEMPHIEQDCHFQ
PTRSQINSQDHMPVPKRHNYSTAPPKQFNKYQSNPSNNSYGYNNNNNNNQHANGQYNNQN
KRKGSYGNHKPSKYEEQNKKFKKY


>TTHERM_00133759(coding)
ATGAGTCAAGAAGATTTAAATGATATAGAGGAAGGTGAATTAGAGGCAAAAGATTTTGCA
GACGACTACTAGTATGATAGAGTTACTTTGGATTAAATTAGATCCAGAGATATAAATGAG
GATTATGAAGTATTACACGAAGTAGGATCTGGTACTTATGGTCGCGTCTATAAAGCTAAC
AGAAAGTCAGTCAGTAATAAATTGTATGCATTGAAGTAGCTAGATGTATCATAAGAGAAA
GATGGATTTCCAATCACAGCACTTAGAGAGATAAAACTTTTATAGAAGTTAGATTAGGAA
AATGTATTGAAAATAAATGAAATCGTGACTATGAGAACAAGCAAGGATAAAGGCAAATCA
AAGATTACAACTTTTTTAGTATTTGATTATATGGAGCATGACTTTTAGGGTTTAATTAGA
AAAAAGTAGCCATTCACTTAGCCATAAATAAAATGTGTGATGTAGCAGCTATTTAAAGGA
TTAGATTACTTACATAATAGCAATGTCATCCATAGAGATCTAAAAAGTGCAAATTTACTG
TTAAATAAAGATGGAGTTTTAAAAATTGGTGATTTTGGTCTTGCAAGATAAGTTGAAAGA
CCTCTTTTAAGACCTTTAACATCGGTTGTAGTAACTCTTTGGTACAGAGCTCCTGAAATT
CTTTTAGGTGATAAAAATTATAGTTTTAAGAGTGATGTTTGGAGTGCTGGGTGCTTCATG
GCAGAGCTCCTTCTGGGAGAGCCTATCTTCAATGGAAAAAATGAAAGTACTTAAATAGAA
TAAATTTATGAAAAATGTGGCTCTCCTGATCCAGATTCTTGGGCAGGCTTGACAACTTTT
AAATTTTGGAAAGATTTACAACCCAAAAAAGAGTATAGTGCTTCCTTAATATCATACATG
AAATAAAAAATACCTACAATCGATTCAAGTACATTAGATTTCTTGTAAGCCCTTTTGACC
ATGAATCCAGAAGAAAGATTAGATTCAAATTAAGCATTACATCATGAATATTTTGAGAGA
GAACCACTTCCCTGCCCTGTTTCAGAAATGCCTCATATAGAACAAGACTGTCACTTCTAA
CCAACTCGCTCTTAAATAAATAGCTAGGATCATATGCCTGTTCCTAAAAGACATAATTAT
TCAACTGCCCCTCCAAAACAATTTAATAAATATTAATCTAACCCATCTAATAATTCTTAC
GGGTATAATAATAATAATAACAATAATTAGCATGCAAACGGATAGTATAATAACTAAAAT
AAAAGAAAAGGATCTTATGGTAATCATAAACCAAGCAAATATGAGGAATAAAACAAAAAA
TTTAAAAAATATTGA


>TTHERM_00133759(gene)
ATGAGTCAAGAAGATTTAAATGATATAGAGGAAGGTGAATTAGAGGCAAAAGATTTTGCA
GACGACTACTAGTATGATAGAGTTACTTTGGATTAAATTAGATCCAGAGATATAAATGAG
GATTATGAAGTATTACACGAAGTAGGATCTGGTACTTATGGGTAATTAATTAATCATTTT
TATTTAGCATCTATAACATTAAAAAATTGTATTTTTCCATAAAAGTCGCGTCTATAAAGC
TAACAGAAAGTCAGTCAGTAATAAATTGTATGCATTGAAGTAGCTAGATGTATCATAAGA
GAAAGATGGAGTAAAGATTAAACAACATATTAGAATCTATATTTTTATAATTTTAATCTT
ACTTAAAAGTTTCCAATCACAGCACTTAGAGAGATAAAACTTTTATAGAAGTTAGATTAG
GAAAATGTATTGAAAATAAATGAAATCGTGACTATGAGAAGTAAATTTAGCAAATTATTG
CATAAATTAATGATTAAAAAATTTATTGTATTTAAAGCAAGCAAGGATAAAGGCAAATCA
AAGATTACAACTTTTTTAGTATTTGATTATATGGAGCATGACTTTTAGGGTTTAATTAGA
AAAAAGTAGCCATTCACTTAGCCATAAATAAAATGTGTGATGTAGCAGCTATTTAAAGGA
TTAGATTACTTACATAATAGCAATGTCATCCATAGAGATCTAAAAAGTAATTTGCAATTA
TTAATTAAAAATACTTGATTGAATTTGCTTATAAACAAAATTTAATCTTATTCCGCGAAC
AATTAAAAAGTATTTAAATCAAATTAATAGGTGCAAATTTACTGTTAAATAAAGATGGAG
TTTTAAAAATTGGTGATTTTGGTCTTGCAAGATAAGTTGAAAGACCTCTTTTAAGACCTT
TAACATCGGTTGTAGTAACTCTTTGGTACAGAGCTCCTGAAATTCTTTTAGGTAAATTAA
TAAATATCATAAGGGAATCTCAAAGTAAGTTAAAATAATGTAAACAGGTGATAAAAATTA
TAGTTTTAAGAGTGATGTTTGGAGTGCTGGGTGCTTCATGGCAGAGCTCCTTCTGGGAGA
GCCTATCTTCAATGGAAAAAATGAAAGTACTTAAATAGAATAAATTTATGAAAAATGTGG
CTCTCCTGATCCAGATTCTTGGGCAGGCTTGACAACTTTTAAATTTTGGAAAGATTTACA
AGTATATAAAAAAATATTTTAATTTTAAAATATATTCAAATTTAATTTTAAAACAGCCCA
AAAAAGAGTATAGTGCTTCCTTAATATCATACATGAAATAAAAAATACCTACAATCGATT
CAAGTACATTAGATTTCTTGTAAGCCCTTTTGACCATGAATCCAGAAGAAAGATTAGATT
CAAATTAAGCATTACATCATGAATATTTTGAGAGAGAACCACTTCCCTGCCCTGTTTCAG
AGTAAATCATCTTAAACTAAAAGTTTATTTTTAAAAAAATAAATATATATATAAAAAAAC
AGAATGCCTCATATAGAACAAGACTGTCACTTCTAACCAACTCGCTCTTAAATAAATAGC
TAGGATCATATGCCTGTTCCTAAAAGACATAATTATTCAACTGCCCCTCCAAAACAATTT
AATAAATATTAATCTAACCCATCTAATAATTCTTACGGGTATAATAATAATAATAACAAT
AATTAGCATGCAAACGGATAGTATAATAACTAAAATAAAAGAAAAGGATCTTATGGTAAT
CATAAACCAAGCAAATATGAGGAATAAAACAAAAAATTTAAAAAATATTGA