Identifiers and Description

Gene Model Identifier

TTHERM_00133700

Standard Name

None

Aliases

PreTt24293 | 10.m00342 | 3698.m00064

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00307 ) Calponin homology (CH) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00133700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05733.13.998559355394521e-152hypothetical protein (306 aa)
OxytrichaContig2939.0.g264.999456391042964e-45Calponin homology (CH) domain
SGDYER016W2.000470901975128e-28BIM1 Microtubule-binding prote
in that together with Kar9p ma
kes up the cortical microtubul
e capture site and delays the
exit from mitosis when the spi
ndle is oriented abnormally
DictyBaseDDB_G02836077.003307964816097e-28eb1 on chromosome: 4 position
912876 to 914543
WormBaseWBGene000121562.0009605191578312e-25locus:ebp-2 status:Confirmed
UniProt:Q9XXA2 protein_id
:CAA20332.1
Stentor CoeruleusSteCoe_290683.873997628687187e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00133700(coding)
ATGAACGAGGCGTTTGGTATGATGGATGAAGGTTACTTTAAACCTAGATCTGAAATTCTT
AAATTTATAAACGATCTTCTTGGATTGAATGTCACTAAGATTGAAAGTTTAGGTTAAGGT
GCAGTCTATTGTTAAATTTTAGATGCTATGTTCCCTGGAAAGGTGTCTCTTCAAAAGGTT
AATTGGAAAGCTAAACTTGATTGGGAATTCGTCAATAACTTAAAAGTGCTTTAGACAGCA
TTTACAAAGTTAGGAATAAAACGTATCATTGAAGTAGAGAAACTCTCTAAATGCAAGTAT
TAGGATAACCTTGAGATGATTTAATGGTTAATGCGGTTTTACGAATGTAATTGTAATAAG
CCTCCTGGTGAGTATGATGCTGCAGCCAAGAGAAAAGGTGTAGAACCTGATTTTTCATTT
GCAGATAAAATTGTTGTGCCAAAAATATTTAATCCTTCAATGAATAAACCACAAGAAGAG
TAGTCCGAAAAACCTAAAAAGCAAGTTACATCTTCACATGCAACTACTACTGCAACTAAT
TTCCATCAAAATAATGCTTCAAAAAAGGCTGCTGATAGTAATGAGTAAAAGGCCCCTTCC
TAAAAACTTATAGATAGTCAATAAAATAAAGGAAGAAGCTCAAGCTCAAATATCCCACCA
CCAAAAGCATTAGGAGCTAAAAGTGACACCCCAATGGAAAAACTTGATAAGATAAAGAAA
ATAATTCAAAAAATAGATGCAAGTGATGCTGAAAAACTAGCATAAATTTCTAAGATCGTT
GGTATTAAAAATACCTAAGCACTCCATTAAGAAACTCATGAGGAGCAAAAAATTAACACC
GATTAACATCATGAATAAGAAATTAAAATAAACTAAGAGCATGAACAAATAGTATAAGAA
CATGAGCATTCTCATAATTTACTTCATTAAGAAGATGATGAGAATCTAATGAATAATGAA
GAAGAGCATGATTTAAACAAAAACAATGATCATGAAGATGAAGAATGTCTCTGA


>TTHERM_00133700(protein)
MNEAFGMMDEGYFKPRSEILKFINDLLGLNVTKIESLGQGAVYCQILDAMFPGKVSLQKV
NWKAKLDWEFVNNLKVLQTAFTKLGIKRIIEVEKLSKCKYQDNLEMIQWLMRFYECNCNK
PPGEYDAAAKRKGVEPDFSFADKIVVPKIFNPSMNKPQEEQSEKPKKQVTSSHATTTATN
FHQNNASKKAADSNEQKAPSQKLIDSQQNKGRSSSSNIPPPKALGAKSDTPMEKLDKIKK
IIQKIDASDAEKLAQISKIVGIKNTQALHQETHEEQKINTDQHHEQEIKINQEHEQIVQE
HEHSHNLLHQEDDENLMNNEEEHDLNKNNDHEDEECL


>TTHERM_00133700(gene)
ATGAACGAGGCGTTTGGTATGATGGATGAAGGTTACTTTAAACCTAGATCTGAAATTCTT
AAATTTATAAACGATCTTCTTGGAGTAAGGAATTATTATTACAGACTTTAAATTGAATAC
ATAATCTAACTTTTAAAATAATTTAGTTGAATGTCACTAAGATTGAAAGTTTAGGTTAAG
GTGCAGTCTATTGTTAAATTTTAGATGCTATGTTCCCTGGAAAGGTGTCTCTTCAAAAGG
TTAATTGGAAAGCTAAACTTGATTGGGAATTCGTCAATAACTTAAAAGTGCTTTAGACAG
CATTTACAAAGTTAGGAATAAAACGTATCATTGAAGTAAAATTAACTACTTAAAACATTT
TAAATTTAGTTTCTTATAAGATAAATTTAAGTGATTTGGATGACATAATTTTATTTTTAA
TAAGGTAGAGAAACTCTCTAAATGCAAGTATTAGGATAACCTTGAGATGATTTAATGGTT
AATGCGGTTTTACGAATGTAATTGTAATAAGCCTCCTGGTGAGTATGATGCTGCAGCCAA
GAGAAAAGGTGTAGAACCTGATTTTTCATTTGCAGATAAAATTGTTGTGCCAAAAATATT
TAATCCTTCAATGAATAAACCACAAGAAGAGTAGTCCGAAAAACCTAAAAAGCAAGTTAC
ATCTTCACATGCAACTACTACTGCAACTAATTTCCATCAAAATAATGCTTCAAAAAAGGC
TGCTGATAGTAATGAGTAAAAGGCCCCTTCCTAAAAACTTATAGATAGTCAATAAAATAA
AGGAAGAAGCTCAAGCTCAAATATCCCACCACCAAAAGCATTAGGAGCTAAAAGTGACAC
CCCAATGGAAAAACTTGATAAGATAAAGAAAATAATTCAAAAAATAGATGCAAGTGATGC
TGAAAAACTAGCATAAATTTCTAAGATCGTTGGTATTAAAAGTAAATAAACTAATTTCAA
AAATTTTTAAAAATAAAAATTAGCCTACAAAATATTTTCTTTTTATCGCTTATTGAAATA
TTAAAAAAAATTTTTTATTTAGATACCTAAGCACTCCATTAAGAAACTCATGAGGAGCAA
AAAATTAACACCGATTAACATCATGAATAAGAAATTAAAATAAACTAAGAGCATGAACAA
ATAGTATAAGAACATGAGCATTCTCATAATTTACTTCATTAAGAAGATGATGAGAATCTA
ATGAATAATGAAGAAGAGCATGATTTAAACAAAAACAATGATCATGAAGATGAAGAATGT
CTCTGA