Identifiers and Description

Gene Model Identifier

TTHERM_00123780

Standard Name

None

Aliases

PreTt27292 | 8.m00552 | 3812.m02580

Description

polycystin cation channel protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.4%

TetraMine Data

TTHERM_00123780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20502.19.997093137033517e-262hypothetical protein (1199 aa)
OxytrichaContig3081.0.g763.0002687256732656e-20Ion transport protein
SGDYOR087W0.000004000864880866421YVC1 Vacuolar cation channel,
mediates release of Ca(2+) fro
m the vacuole in response to h
yperosmotic shock

General Information

Paragraph NoGene NameParagraph Text
124TTHERM_00123780This protein is a homolog of proteins in the polycystic cation channel transmembrane protein family. It contains one domain; the domain (E-value = 1.2 -10) is known as CL0030, which contains the cation channel region of PKD1 and PKD2 proteins. PKD1 and PKD2 functions through a common signaling pathway that is necessary for normal tubulogenesis. Tubulogenesis is the formation of tubules in epithelial or endothelial cells that transport liquid and gas throughout the body. In humans, the mutations in PKD1 and PKD 2 form thousands of cysts which inhibits the protein from efficiently carrying liquid and gas throughout the body. It is possible that in Tetrahymena this protein is an integral membrane protein. Paragraph by: Deborah Yi-an Lin, Keck Science Department, Scripps College

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00123780(coding)
ATGCTGAAATACTTGCATCAGAATTTAATTTTGAAAAACTACAACAACGAAATTGAGTTG
ATTTTAAACATGAATGAAAATAATTTAGAGCTTTTATCCTCTAAATATGTTCTTTATATT
GCTAAATATGAACGTATTCCGCCTAATTATATATTAAATAGGACTCTAATTAAGTAGGTT
GTTTATTAGTAAAATGTACCATTAATGTCTGCTATGCTCAAACTAGATAGAGTTATCACT
TAGTAAACACTTCATTCAAAGAAGGTTTAGGCTTAAATTAATGTGTTTCTTTCTTAAGCT
GACACTTTTTGTATGGGATTATATTTTCTTAAAAAAATGTCTTAAAAAAAGTAAATTATT
TCTTAATCATCTGAATATTTAGAGACCATTTTGAGATTGCTAGAGAAACCTAAAAGCGAT
GAAAAATTCGCCTTTGAAATTTTTAGTCATGTGCTTCATCCACTAATTTTATGCTTAGTC
GCAAGTAAAATTTTGTTAAAACTATCATTCTTCAAAAATCCTTTCAGCTCAGAGATGCTC
AAACTAGCAAAATACTATTTGGAAAGAGCTTTACTGTTTAGAGATACAATTTTTGATGCA
AGAGAAATGAGCCTCATTCTCTTTAAACCCCTTTTCCCTAGCGATAAGCCTTTAGTTAAA
GCTTTGAGAAACAGAAATTACTGCTAGTTTTTTACAGAGTTTTTTATTCATCCATGCATA
ACATATCTTCTTGAACAGAAATGGATGAGTACGTATGGTTTTGACTACTCACTTTTAAGC
ACATTTACTCCTTTATGTCATTTTTAAAAGTAAGCCAGAATCAAAAATACAATTGCTAAA
GGCTCAAAATCATCATCATCTTCAACAAGTTCATTTTAAAAATCAATGAAATCAACAGGT
TCTTCAGCTTCTTTTTCTCTTGAACCACAGAAATAAAACTGGATAATTTTCAGAGATATT
GAGGTCAGTTAACTGAAGAAAGCAACAAAAAATAATCATTTTTATTAATTTGTTATTTAT
AACAAATCAGTTTAAGTGAGAACTTTTTTCGAGTTTATCCTTTTTCTGGCAATCTTTTGT
TTCACTTTATATGAACTATTTCTATTTATAGAAAATCTAAATAGCTATGCTTCAGTTGAT
GATCCTGTAAAAATAATGTTATTCTCATCAACTGTACCGTAAGATTGGTAAAGTAAAGTG
AATGACTTCAAAAAGTAAAATCCAACACCACCTCCATTAGATATTTAAATAGATAATACT
ACAAATCTTAATATTTAAACAACAGATCCTTAGATTTTTTGTAAACTAATCTTATACTAA
ATATCTTCGGGTTATCAAGAATTTATGGATTTTTTTTAAAGTTAGTGCGTTAAATTAATT
TATGTTGGTACTTAATTTGAAAAACTCTGTAACGATACAATCAGAGTACTTTGGTTCATT
TTCTGTATTGGAGCAAATGCCATTTAAAAGCAAATTTATGTATATCTTATAAGACGAAAA
ACTGATCCCTAAATATTAGATTTGTATGATTTACTCCTCTACATAGCTTGTGGCTCATTT
TTATTGACAAAGCAAATATTTATTCCTGAAGGTATATCTGCTAATTATACTTTTGAATAC
TTCAACAATTGTTAATTTGCTTTGAAAATTGAATGCTGTGCTATAGTGTTTATTTTATGG
CTTAGAATGTTTATATTTTTAATTAGAACTTAAAAATTTGGATTACTAGTCAAAGTAATA
ATACTATTTACTAAAGACCTTTTATATTTTATGGTCATTCTTATTACTGTCACAGTCGCT
TTTGGGCTAATCAATTACATTCTTTTTTAAAATAGCCTTGAACTATATAAATCTATTGAT
AAATCCATATTCAATCTATTTGCTGCAGCTTTTGGTGCATTCGATTTTAACAATTAAACT
GGAATTTAGTCAGCGATTCTAATTGTTTTTTTAGTTGTAGTGAATGTTATCCTTCTTAAT
TTACTAATTGCTATATTAAACACGAGATATGAGAAGACAATGCAACAATCAGAGATGGAA
TACTCTTTAGTAGTATATAATGACTATATTAATTCAAGATTTAACCCTATATACATGTCT
ATGATTTCACTACCTCCACCTTTTAATATCCTTAATTTTATATTTGGAATAATTTCTTTT
ATAACTAAGTCTAGAATATGGAATAAAATAGCTTTAAAAATTGGATACACATTAGTTATA
TTTCTTCCTTGTATTTTACTCTACATAGCTCTTTCTTTGGTTCTCATTCCTTTTTCTTAT
TTATATTTTATCCATTAAGTATCAATGTATTCTTTTTCTGATAATATGATGTATGCCAGA
AAGAAAAATAAATGCTTCAAGATTACACTTTATTTATTTCGATTACTGACTTGGATTACA
TTAGGTATTCCTTATTTACTTGTAGTGTTTTTTTCAAATGATCTGCCTTTGTTTTGTAAA
TCGGCCTTTGCTCATAACAATAATAAGTACAATTTCACTAAAAATCCTGTCCTTGACTTA
AGAGTAATAAAGTATGTGTCTCTTTACTCTAATTATTTAAATTTAGCAAAAAAAGATGTA
TTTAACTATTTAGAATTTAGGTCTTCGCTTGAGCAAAAAAAGGAAGTAAAATATAAAAAA
TCTTACTTTCAAAGATTTGCACAACCTTCTATCAAATCTAATAGCTAGCCTCTATAATAA
ATTAGGAAAGGATTTTAAAATAATGTAAAGCATAATTTTAAATCAGAAACCATATTTGAA
AAAAATTTTAATGATGCAGTTAAAAAATTTGGAGATTCTAAAGTAAAATAAGAAGTAGAA
AATATCCAGCTTAATAATCTTTTAAAAGCAATAAAATATTCAGCAATCTTCTTTAAAAAA
TCAAAGAGTACTTCGTTTAACTTGTCTAAACTTCTTTACATTGTAAAGAAAAAAGAAATA
AATTTAAATCTTCTGTAATTAAATACTGATAATTTTTTCTTAAATAGATCATTTAGCTCA
TAACCTAACATAAATGTTAATAACTTAAATTGA


>TTHERM_00123780(protein)
MLKYLHQNLILKNYNNEIELILNMNENNLELLSSKYVLYIAKYERIPPNYILNRTLIKQV
VYQQNVPLMSAMLKLDRVITQQTLHSKKVQAQINVFLSQADTFCMGLYFLKKMSQKKQII
SQSSEYLETILRLLEKPKSDEKFAFEIFSHVLHPLILCLVASKILLKLSFFKNPFSSEML
KLAKYYLERALLFRDTIFDAREMSLILFKPLFPSDKPLVKALRNRNYCQFFTEFFIHPCI
TYLLEQKWMSTYGFDYSLLSTFTPLCHFQKQARIKNTIAKGSKSSSSSTSSFQKSMKSTG
SSASFSLEPQKQNWIIFRDIEVSQLKKATKNNHFYQFVIYNKSVQVRTFFEFILFLAIFC
FTLYELFLFIENLNSYASVDDPVKIMLFSSTVPQDWQSKVNDFKKQNPTPPPLDIQIDNT
TNLNIQTTDPQIFCKLILYQISSGYQEFMDFFQSQCVKLIYVGTQFEKLCNDTIRVLWFI
FCIGANAIQKQIYVYLIRRKTDPQILDLYDLLLYIACGSFLLTKQIFIPEGISANYTFEY
FNNCQFALKIECCAIVFILWLRMFIFLIRTQKFGLLVKVIILFTKDLLYFMVILITVTVA
FGLINYILFQNSLELYKSIDKSIFNLFAAAFGAFDFNNQTGIQSAILIVFLVVVNVILLN
LLIAILNTRYEKTMQQSEMEYSLVVYNDYINSRFNPIYMSMISLPPPFNILNFIFGIISF
ITKSRIWNKIALKIGYTLVIFLPCILLYIALSLVLIPFSYLYFIHQVSMYSFSDNMMYAR
KKNKCFKITLYLFRLLTWITLGIPYLLVVFFSNDLPLFCKSAFAHNNNKYNFTKNPVLDL
RVIKYVSLYSNYLNLAKKDVFNYLEFRSSLEQKKEVKYKKSYFQRFAQPSIKSNSQPLQQ
IRKGFQNNVKHNFKSETIFEKNFNDAVKKFGDSKVKQEVENIQLNNLLKAIKYSAIFFKK
SKSTSFNLSKLLYIVKKKEINLNLLQLNTDNFFLNRSFSSQPNINVNNLN


>TTHERM_00123780(gene)
ATGAGTCAAAACAAAAAGCTCAATCTTTTAGATACCTTGCAGCCTGTTTCTGCAGAAAGG
TTTATCTCTTCTCGAAATACTTAGAAGGGATTTGAGCTCGCAAGTCCATCTGTTTAATCT
AATTTTTTTGAGGATTAGATTTTAAACATAGAGAACTAGTTGGATGAATATTTAGAGCTA
ATGGAAAATAAAATGAAAGAAATAAGCGAACAAAGATTATAAGATAATTTGTAATTTATG
AATGAGCTAAAATTCATAGTTGCAGAAAGCAAAAACAATTAGTAAAAAAAGAAGGAGTTT
TTAAAATACTATCATTATTTTTAAGCTATTATGGATGCTGGAGAGAAGCAGAAACCTTAA
TGAGATAAATATAAAGCAATAACAACTTAGGAAGTAGGGGAGGAAGCTAACCAAAAAGAG
AAGTTTATGATATATATGATTTTATTTTGGAGCTTATTGAAAATGAGAATGAAATGAGCA
AAATGATGAAAGTTTTGTTTTCATAGGAAAGTAGAATCTAATAGGAACAAAGAGAATAAA
TGGATACATCTTCTTAAATTTACAATTTTAAATAAAATATATTTTTAGCTATTATACAAA
CATTTAACATAAGAATGAATTCAATAAATGATGAGATATTCAGCTGGCTAATAGACAACT
AAAAACTCAGGATAATTGAGATAATTTTAGAAAATGACAGATTTAGCGCATCATTAAAAT
AAGGCAATTATTAAAGAATGAAAAAACAAGAAAGAAAAATGCTGAAATACTTGCATCAGA
ATTTAATTTTGAAAAACTACAACAACGAAATTGAGTTGATTTTAAACATGAATGAAAATA
ATTTAGAGCTTTTATCCTCTAAATATGTTCTTTATATTGCTAAATATGAACGTATTCCGC
CTAATTATATATTAAATAGGTAGTAGTTTATTATTTAATTTTTTTTTTTTTTTTGATTTC
AGATTCAACTCAAAAGTAAATTGAATCTGTAAGATATTTTTAAAAGTGCGATTTCATCAA
ATTTTTAAAAAATTTTGGTTTTCGATTTTAAATTCATTCATTTTATTTTATTGTTTGCTG
TTTATCAAATCTCATCAAAAATAATTAAAATGCATTTTTTTTACTTTTAAATTATAATTA
GGACTCTAATTAAGTAGGTTGTTTATTAGTAAAATGTACCATTAATGTCTGCTATGCTCA
AACTAGATAGAGTTATCACTTAGTAAACACTTCATTCAAAGAAGGTTTAGGCTTAAATTA
ATGTGTTTCTTTCTTAAGCTGACACTTTTTGTATGGGATTATATTTTCTTAAAAAAATGT
CTTAAAAAAAGTAAATTATTTCTTAATCATCTGAATATTTAGAGACCATTTTGAGATTGC
TAGAGAAACCTAAAAGCGATGAAAAATTCGCCTTTGAAATTTTTAGTCATGTGCTTCATC
CACTAATTTTATGCTTAGTCGCAAGTAAAATTTTGTTAAAACTATCATTCTTCAAAAATC
CTTTCAGCTCAGAGATGCTCAAACTAGCAAAATACTATTTGGAAAGAGCTTTACTGTTTA
GAGATACAATTTTTGATGCAAGAGAAATGAGCCTCATTCTCTTTAAACCCCTTTTCCCTA
GCGATAAGCCTTTAGTTAAAGCTTTGAGAAACAGAAATTACTGCTAGTTTTTTACAGAGT
TTTTTATTCATCCATGCATAACATATCTTCTTGAACAGAAATGGATGAGTACGTATGGTT
TTGACTACTCACTTTTAAGCACATTTACTCCTTTATGTCATTTTTAAAAGTAAGCCAGAA
TCAAAAATACAATTGCTAAAGGCTCAAAATCATCATCATCTTCAACAAGTTCATTTTAAA
AATCAATGAAATCAACAGGTTCTTCAGCTTCTTTTTCTCTTGAACCACAGAAATAAAACT
GGATAATTTTCAGAGATATTGAGGTCAGTTAACTGAAGAAAGCAACAAAAAATAATCATT
TTTATTAATTTGTTATTTATAACAAATCAGTTTAAGTGAGAACTTTTTTCGAGTTTATCC
TTTTTCTGGCAATCTTTTGTTTCACTTTATATGAACTATTTCTATTTATAGAAAATCTAA
ATAGCTATGCTTCAGTTGATGATCCTGTAAAAATAATGTTATTCTCATCAACTGTACCGT
AAGATTGGTAAAGTAAAGTGAATGACTTCAAAAAGTAAAATCCAACACCACCTCCATTAG
ATATTTAAATAGATAATACTACAAATCTTAATATTTAAACAACAGATCCTTAGATTTTTT
GTAAACTAATCTTATACTAAATATCTTCGGGTTATCAAGAATTTATGGATTTTTTTTAAA
GTTAGTGCGTTAAATTAATTTATGTTGGTACTTAATTTGAAAAACTCTGTAACGATACAA
TCAGAGTACTTTGGTTCATTTTCTGTATTGGAGCAAGTAAAATAAATTTATTTTATCAAT
AAAATAGCTAAAATTAAATTATTTAATTATTTATTTTTATTTTTCATTAACTAATTATTT
TTTTTAATAGATGCCATTTAAAAGCAAATTTATGTATATCTTATAAGACGAAAAACTGAT
CCCTAAATATTAGATTTGTATGATTTACTCCTCTACATAGCTTGTGGCTCATTTTTATTG
ACAAAGCAAATATTTATTCCTGAAGGTATATCTGCTAATTATACTTTTGAATACTTCAAC
AATTGTTAATTTGCTTTGAAAATTGAATGCTGTGCTATAGTGTTTATTTTATGGCTTAGA
ATGTTTATATTTTTAATTAGAACTTAAAAATTTGGATTACTAGTCAAAGTAATAATACTA
TTTACTAAAGACCTTTTATATTTTATGGTCATTCTTATTACTGTCACAGTCGCTTTTGGG
CTAATCAATTACATTCTTTTTTAAAATAGCCTTGAACTATATAAATCTATTGATAAATCC
ATATTCAATCTATTTGCTGCAGGTATAATTAATTAACTTATTTAAAGTCTCATAAATATT
TTAACAAAGGTTTAAACTTTTTAAAAAGAATATTAGTATTAATATTAAGATATTTCATAA
TTATTTAATTAAATAAGCAAATCAAAAAATTTATTGAAATATATCCCACACTATTATCAA
AAAATACTTTAAATTTGACTTAAAAACTAAGTTATTTTTTATTATTAAATTTATAAAAAC
CTCAACAAATGCATTTTTAGTTCCTAAAAATGTTTAAATTAGATATAATTATTTATTTAT
TTCTTGATTGATTGATAGATATATAAATTGATGAATTAATTCATTTATTAAAATTACATT
TTTATTAATAAAAAAGCTTTTGGTGCATTCGATTTTAACAATTAAACTGGAATTTAGTCA
GCGATTCTAATTGTTTTTTTAGTTGTAGTGAATGTTATCCTTCTTAATTTACTAATTGCT
ATATTAAACACGAGATATGAGAAGACAATGCAACAATCAGAGATGGAATACTCTTTAGTA
GTATATAATGACTATATTAATTCAAGATTTAACCCTATATACATGTCTATGATTTCACTA
CCTCCACCTTTTAATATCCTTAATTTTATATTTGGAATAATTTCTTTTATAACTAAGTCT
AGAATATGGAATAAAATAGCTTTAAAAATTGGATACACATTAGTTATATTTCTTCCTTGT
ATTTTACTCTACATAGCTCTTTCTTTGGTTCTCATTCCTTTTTCTTATTTATATTTTATC
CATTAAGTATCAATGTATTCTTTTTCTGATAATATGATGTATGCCAGAAAGAAAAATAAA
TGCTTCAAGATTACACTTTATTTATTTCGATTACTGACTTGGATTACATTAGGTATTCCT
TATTTACTTGTAGTGTTTTTTTCAAATGATCTGCCTTTGTTTTGTAAATCGGCCTTTGCT
CATAACAATAATAAGTACAATTTCACTAAAAATCCTGTCCTTGACTTAAGAGTAATAAAG
TATGTGTCTCTTTACTCTAATTATTTAAATTTAGCAAAAAAAGATGTATTTAACTATTTA
GAATTTAGGTCTTCGCTTGAGCAAAAAAAGGAAGTAAAATATAAAAAATCTTACTTTCAA
AGATTTGCACAACCTTCTATCAAATCTAATAGCTAGCCTCTATAATAAATTAGGAAAGGA
TTTTAAAATAATGTAAAGCATAATTTTAAATCAGAAACCATATTTGAAAAAAATTTTAAT
GATGCAGTTAAAAAATTTGGAGATTCTAAAGTAAAATAAGAAGTAGAAAATATCCAGCTT
AATAATCTTTTAAAAGCAATAAAATATTCAGCAATCTTCTTTAAAAAATCAAAGAGTACT
TCGTTTAACTTGTCTAAACTTCTTTACATTGTAAAGAAAAAAGAAATAAATTTAAATCTT
CTGTAATTAAATACTGATAATTTTTTCTTAAATAGATCATTTAGCTCATAACCTAACATA
AATGTTAATAACTTAAATTGA