Identifiers and Description

Gene Model Identifier

TTHERM_00122270

Standard Name

Shulin

Aliases

PreTt27242 | 8.m00502 | 3812.m02528

Description

Shulin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00122270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11692.19.997093137033517e-262hypothetical protein (1199 aa)
OxytrichaContig12688.0.g767.996547841088611e-53AAA domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00122270(coding)
ATGTTCAACTTTTTTAGTAGTGCAAATATAAATTAAAATATCCCAAAGTATAGCGTTAAT
GACTTTGTTTTTAGGTTGAAAAAGATAGAGAAAATTGTAGTTAAGGAAGGTTTGGACGGA
TTTCTCTTGATTAATGGAGTAGATTCTCGTGAAAATACAGAATATGTCAAATTGACAAAT
TGGCTTTTTTTAGGAAATTCAGGTTTAGAAATCGAAGAAAATGAGTACTTAAATTAAATT
TACAGCGATATGATAGTATTAATTAAGAAAGGAACTACCCATATTTTCATAGACCCAGAA
GCATTAAATTCTCTTCAAACTCTTATTTACAGTATTCCTAATGTTGATGTTTTCTGTCCT
ACTGAGAAACAATATGAAGATAAAGATGAAATGGAGCTTCTCAAAATGGCTTTTTTCCTT
AGGGTAATGAAGCCAACAAAAAAAGTTGGTATTTTATTAGGCTAAAAAGACAAAGGAAAA
ATCAATTCAATTGAAAAGTGGCCATTAATTCAGTCATATGGATTAGAAGAATTAGGAGTT
GGGTTTTTTAGCATGAACCATGAAGTAGTTGATCTCACTCTAAGATTGAATGCAGTTTAT
AAAAATTATGATAAGTTCTTTGTCTCGAAGTTAATCTATGTAGTAGCTAAGAGACTAACT
GGTCACTTCAACTCAGCAGCAGGTTAGTTAGGAGATATGAAAATGCATAAAAGAAATTTA
GCAACTGAAAGTTAACTAACAGAAATATTTAGGGATACATATGAAATAGAAGAAATAAGT
AAATGGGTGTAAATTAGGGGTGTAAACGCTGCTCTACCAAAGCCAAGAGTGTTATTTGGT
AAGAATACTTCTGCAGACTGCTCTAAAGAACCTTCAGTTGCACCATTAAAAGATTTAAAA
TACTCAGAAACTTTTCATTCATTCCATGCAACTTTTGAAACTTTTGATTTAAGAACCTGC
TTAAGAGCAGCAAGAACTTACTTTTTAGCAAAGGGAGTCAAAGAGGAAAGAAACCTTATC
ACTTTAAATGATGATGAAGGCGTTCCTTAAGGATATGAGTTAAATATAGATGAAAATTAG
CAATACAAAGACTAAGACTTTTTGGCTAACTTATATCTTTCTATCATAATCGGATTCAAT
GAAGTTATGCAATTGATTACAAAAGACTATAAAAATATGACTGAAGAATTTATCTAAGAT
TATATTTTTTAGAAGGTTTCTAAAGTTTATGCTGGTTTCTAAATCCCAGAAAGCGAAATT
ACTTTGGATAAAATCTAAATTATTTTGAAAGCATACAACTCCTTTGGTGAAGAAGTTAAA
ATTGATTTTAAAGACACAATTTCTTTCAAGCTTACTCCTTATTTCTTCATGGTTAGAATA
GAATAAAAAAATATTAAAAGTTAAATTCTAAACAACACAGTCCTAGGTTCTTTAGTTTTT
GCTGAGTCTTTTATTTTGCAAGAAGGTTGCTATTTACTATTAACAAAAGAAATACCTTAT
TTTGACCTATGGAACTGCTAAAATGATTACTCTGAAAAGATCGAAAAAATGAAAAAAAGA
ATTTTATGGGAACCTCTTGGCAAGTAAATTTCAGATGAATTACCTAAGAATAGAATATTC
GTTTAGACAGGTAGAAAAAGTAATTATGGGTTTGATATCCCTATTATGCAGGCTAGTTAT
TATATGCATGAATTAGGTTTAAGAATAGAAACTTAAAGACTAGGATGGTTCATATTATTT
TTCAAAGAAATGAAAGAAATTCAAATAACATAAAAAATGAATCACACTTGGCTTATATTT
AAAGTCGATTCTAATATAACTTTTAATTCAATAAGCAAAGACACTATTGCTTTAGAGTTT
ACAGGTGATGCTCTTGAACAATCATTTTTTAAGATAAAAAATTATTTTGAAGAAAACTAA
ATTAAGTATGAGTATTAGGTTGATATTCCAGCAATATTTTAAGAATCATAGATAGCTAAG
AAACAAATTCTAAATTAATAGTCTTAAGGTTAAAAATTAATCACAATGAATAGCATTTAA
AACGAATAGTTCTTTATATCTTACATCGAAAGCAAGCAACTGATGATCCTAAATCAAATG
AAAGACCTTAAGTTATCTGCTTATAAAAACCTATATGAATAAATGCAAATCAGTTAAGCA
ATCACTCCTGTTGAAAATCATATTGGAGTCATTCTTGTAAATGGTAGCTACTGCTCTGGA
AAAAGAAAATTTGCTGAAAATTTAATAAGATTTGGATCAGACAACAATTTAAGACTTCAT
CTTTACAAATTTGATTTGAATGAAATGAGTGAACTAACAGAAAAATCTTATTTAAGTGGA
CTGCTTAAATTTGCTTCAGAGAAAAAAATATAAAATACTGACGTTATTGTCGCTTCAGTC
CCTCATTTTATTAACACTAAAATTCTTATTGATTACTTTAGCAAGAGCGAAAAAATTTCT
AATGCTTTTTATATCAGAACTATTGCTACAAAAATAAACATAAACAATATCTATTCCAAC
TTTAACAAAAACCCAGTAAACAATGTTTTTACATACGGTGTAGAGGGTTACTCTTAGTTC
TTGCTTTTGGATACCTATAATAATTATGATGCAGATGTAAATGCTTTGAATAAAACTCTC
TCAGGTGTTCTTCCTGGTGCAAAAATTTATAAAATTATGAATAACATTTTGAACCCAGCT
CTTGCTAAAGATATTCTTACTTCTATTACTTTTATTTCTGAGTAAAATAACTTAAATAGA
TTGAAATATTCAGTTTAATATGATCTTTTGACATCAAATGGACCAAGTAGTGTTGTTTTC
ATACCTTTTAAGCTTCCCATTTTGAGAGAAAAGATAAGAGATTTAATTTATAAGAAAATC
CTGCAAAATGGTAACTAAACCCTAGTAGATACAATCGAGGCTGAACAAAAAATTGCAGAA
TTCAAAGAGTTAAACAAAAATTCTAAAGATCCTCTAATGATTGAAATCATTAAATTAAAA
GAAAAAATCGAAATTTAAAATGCTCAAACTAGTGATTAAGCTATTAAAATAGACTATGTT
AAGGGTATATTAAGATATGATAGCAAATTAAAAGAAGGGTTAGAGGAAATAACTATAACA
CCTAATTATTTTATTGAAAGAACTGTAAAAGGAGTTGATGCTAAGGAGTTCACAGAAGAG
CTTAATGGAGTTTCCTTTAAAAATGTTAAATACACTGGAATTACTAATTCTATAATCAAT
GATATGGGTTTCGTTTTTGCTGGAAAAAATCTCAATAAGGAGAAGTTGTTAGAATTATTA
TACAAGCTAGTCAAGCCACTGAATAAGCAAAAGTTAAGATAAAGAAAAGATCTAACAGAA
GAAGAGATAGTTGACATTTAGTTTAGAAACAGAGGAGAAGGTTTAGAAAATGGTGAGTTT
TATGATGGATAATTTTGGAGAAACATTTAAGGTTTGATTCTACCTCACCATCCAAAAAAA
GATGAATTTATTGAAGAATATTTAAAGTAAGAAGAAGTAAGAATAAACCAAATTAATGAA
CAGTTGTAATAAGAATGGGAAACATGGAAATAAGTTTATGATAAGATTCATTTAGACAAG
TGA


>TTHERM_00122270(protein)
MFNFFSSANINQNIPKYSVNDFVFRLKKIEKIVVKEGLDGFLLINGVDSRENTEYVKLTN
WLFLGNSGLEIEENEYLNQIYSDMIVLIKKGTTHIFIDPEALNSLQTLIYSIPNVDVFCP
TEKQYEDKDEMELLKMAFFLRVMKPTKKVGILLGQKDKGKINSIEKWPLIQSYGLEELGV
GFFSMNHEVVDLTLRLNAVYKNYDKFFVSKLIYVVAKRLTGHFNSAAGQLGDMKMHKRNL
ATESQLTEIFRDTYEIEEISKWVQIRGVNAALPKPRVLFGKNTSADCSKEPSVAPLKDLK
YSETFHSFHATFETFDLRTCLRAARTYFLAKGVKEERNLITLNDDEGVPQGYELNIDENQ
QYKDQDFLANLYLSIIIGFNEVMQLITKDYKNMTEEFIQDYIFQKVSKVYAGFQIPESEI
TLDKIQIILKAYNSFGEEVKIDFKDTISFKLTPYFFMVRIEQKNIKSQILNNTVLGSLVF
AESFILQEGCYLLLTKEIPYFDLWNCQNDYSEKIEKMKKRILWEPLGKQISDELPKNRIF
VQTGRKSNYGFDIPIMQASYYMHELGLRIETQRLGWFILFFKEMKEIQITQKMNHTWLIF
KVDSNITFNSISKDTIALEFTGDALEQSFFKIKNYFEENQIKYEYQVDIPAIFQESQIAK
KQILNQQSQGQKLITMNSIQNEQFFISYIESKQLMILNQMKDLKLSAYKNLYEQMQISQA
ITPVENHIGVILVNGSYCSGKRKFAENLIRFGSDNNLRLHLYKFDLNEMSELTEKSYLSG
LLKFASEKKIQNTDVIVASVPHFINTKILIDYFSKSEKISNAFYIRTIATKININNIYSN
FNKNPVNNVFTYGVEGYSQFLLLDTYNNYDADVNALNKTLSGVLPGAKIYKIMNNILNPA
LAKDILTSITFISEQNNLNRLKYSVQYDLLTSNGPSSVVFIPFKLPILREKIRDLIYKKI
LQNGNQTLVDTIEAEQKIAEFKELNKNSKDPLMIEIIKLKEKIEIQNAQTSDQAIKIDYV
KGILRYDSKLKEGLEEITITPNYFIERTVKGVDAKEFTEELNGVSFKNVKYTGITNSIIN
DMGFVFAGKNLNKEKLLELLYKLVKPLNKQKLRQRKDLTEEEIVDIQFRNRGEGLENGEF
YDGQFWRNIQGLILPHHPKKDEFIEEYLKQEEVRINQINEQLQQEWETWKQVYDKIHLDK


>TTHERM_00122270(gene)
ATGTTCAACTTTTTTAGTAGTGCAAATATAAATTAAAATATCCCAAAGTATAGCGTTAAT
GACTTTGTTTTTAGGTTGAAAAAGATAGAGAAAATTGTAGTTAAGGAAGGTTTGGACGGA
TTTCTCTTGATTAATGGAGTAGATTCTCGTGAAAATACAGAATATGTCAAATTGACAAAT
TGGCTTTTTTTAGGAAATTCAGGTTTAGAAATCGAAGAAAATGAGTACTTAAATTAAATT
TACAGCGATATGATAGTATTAATTAAGAAAGGAACTACCCATATTTTCATAGACCCAGAA
GCATTAAATTCTCTTCAAACTCTTATTTACAGTATTCCTAATGTTGATGTTTTCTGTCCT
ACTGAGAAACAATATGAAGATAAAGATGAAATGGAGCTTCTCAAAATGGCTTTTTTCCTT
AGGGTAATGAAGCCAACAAAAAAAGTTGGTATTTTATTAGGCTAAAAAGACAAAGGAAAA
ATCAATTCAATTGAAAAGTGGCCATTAATTCAGTCATATGGATTAGAAGGTAATACTTTG
ATAATAATTAATAAAATAAACTAATTATTGGTTTAGTAAACCGAAAAATAGAACAAGCTT
TCAAGTAAATATTTAAAATTAATCATATTGTTTAAAATAAATAGAATTAGGAGTTGGGTT
TTTTAGCATGAACCATGAAGTAGTTGATCTCACTCTAAGATTGAATGCAGTTTATAAAAA
TTATGATAAGTTCTTTGTCTCGAAGTTAATCTATGTAGTAGCTAAGAGACTAGTAAGTAA
AAGATAGATAATATTTAAAATAACATAATATATTTTTAATAGACTGGTCACTTCAACTCA
GCAGCAGGTTAGTTAGGAGATATGAAAATGCATAAAAGAAATTTAGCAACTGAAAGTTAA
CTAACAGAAATATTTAGGGATACATATGAAATAGAAGAAATAAGTAAATGGGTGTAAATT
AGGGGTGTAAACGCTGCTCTACCAAAGCCAAGAGTGTTATTTGGTAAGAATACTTCTGCA
GACTGCTCTAAAGAACCTTCAGTTGCACCATTAAAAGATTGTAAAACTTATTTCTAAACT
TTAAAATGTAAATTAAGGTTTTGATATAAATATAGTAAAATACTCAGAAACTTTTCATTC
ATTCCATGCAACTTTTGAAACTTTTGATTTAAGAACCTGCTTAAGAGCAGCAAGAACTTA
CTTTTTAGCAAAGGGAGTCAAAGAGGAAAGAAACCTTATCACTTTAAATGATGATGAAGG
CGTTCCTTAAGGATATGAGTTAAATATAGATGAAAATTAGCAATACAAAGACTAAGAGTA
ACAAAAAATTAAATAAAAATAGGATTAACTTTTTTATAAATTAAATAAATAGCTTTTTGG
CTAACTTATATCTTTCTATCATAATCGGATTCAATGAAGTTATGCAATTGATTACAAAAG
ACTATAAAAATATGACTGAAGAATTTATCTAAGATTATATTTTTTAGAAGGTTTCTAAAG
TTTATGCTGGTTTCTAAATCCCAGAAAGCGAAATTACTTTGTAAATAACTTTTTTATAGT
AAATTTAGAAATAAAATTAAATCAATTTTAAAATAAAAGGGATAAAATCTAAATTATTTT
GAAAGCATACAACTCCTTTGGTGAAGAAGTTAAAATTGATTTTAAAGACACAATTTCTTT
CAAGCTTACTCCTTATTTCTTCATGGTTAGAATAGAATAAAAAAATATTAAAAGGTAATA
TTCAAAAAGTCTTAAATCATTTAAATTTGTTAAAGTTTTTATTTTAAATTATTTATAAAT
TATTTTTTATATTTTTTGTTAATTTTTTCTCTTCAAAATGTTTCATTTTTAATCTAAAAA
TAATTTAGTTAAATTCTAAACAACACAGTCCTAGGTTCTTTAGTTTTTGCTGAGTCTTTT
ATTTTGCAAGAAGGTTGCTATTTACTATTAACAAAAGAAATACCTTATTTTGACCTATGG
AACTGCTAAAATGATTACTCTGAAAAGATCGAAAAAATGAAAAAAAGAATTTTATGGGAA
CCTCTTGGCAAGTAAATTTCAGGTAAACAGTTTAATTGAATAAATTTGTTTTAAATACTA
AAACACTGTTTGGATAGAGAAATATTTATATTTGAAAGGATTATTTAGTGAGTAAATATT
TCTTAAAAAAAGAGCAATTTTAAATAATAATAAAAAACAAACTCAAATAAAGAAATTATT
TCATAAAAATTATTTAAATAAATTTTTTATTATGAAAAAGATGAATTACCTAAGAATAGA
ATATTCGTTTAGACAGGTAGAAAAAGTAATTATGGGTTTGATATCCCTATTATGCAGGCT
AGTTATTATATGCATGAATTAGGTTTAAGAATAGAAACTTAAAGACTAGGATGGTTCATA
TTATTTTTCAAAGAAATGAAAGAAATTCAAATAACATAAAAAATGAATCACACTTGGCTT
ATATTTAAAGTCGATTCTAATATAACTTTTAATTCAATAAGCAAAGACACTATTGCTTTA
GAGTTTACAGGTGATGCTCTTGAACAATCATTTTTTAAGATAAAAAATTATTTTGAAGAA
AACTAAGTAAATATTAATTTAGTACAATTATTTGAAATTAATAAGTTTTTTATAGATTAA
GTATGAGTATTAGGTTGATATTCCAGCAATATTTTAAGAATCATAGATAGCTAAGAAACA
AATTCTAAATTAATAGTCTTAAGGTTAAAAATTAATCACAATGAATAGCATTTAAAACGA
ATAGTTCTTTATATCTTACATCGAAAGCAAGCAACTGATGATCCTAAATCAAATGAAAGA
CCTTAAGTTATCTGCTTATAAAAACCTATATGAATAAATGCAAATCAGTTAAGCAATCAC
TCCTGTTGAAAATCATATTGGAGTCATTCTTGTAAATGGTAGCTACTGCTCTGGAAAAAG
AAAATTTGCTGAAAATTTAATAAGATTTGGATCAGACAACAATTTAAGACTTCATCTTTA
CAAGTAAAACAAATAGATATAATTATTATTTTTAAAAGCGTTTTAAAAAAATATAAATTA
AGAAATTTGTTATAATAATTTAAAAATAATTAGATTTGATTTGAATGAAATGAGTGAACT
AACAGAAAAATCTTATTTAAGTGGACTGCTTAAATTTGCTTCAGAGAAAAAAATATAAAA
TACTGACGTTATTGTCGCTTCAGTCCCTCATTTTATTAACACTAAAATTCTTATTGATTA
CTTTAGCAAGAGCGAAAAAATTTCTAATGCTTTTTATATCAGAACTATTGCTACAAAAAT
AAACATAAACAATATCTATTCCAACTTTAACAAAGTAAACCAAATTATTTATTTATTTAT
TTATTTATTTATTTTAAATCAAATTAAATTTTGTAAAGATTTTCCTGATATTGAAATCAA
TGAATGAACCATTAGGAAAATAAATATAAATTAACCTTAAAAATTATTCCTGAATAAATT
AATTTAACTAAATTTAAAAATTAATTCAAATTAAAATAATAAGCTTCTCTTAAAAATTAA
AGTTTAAATAGAAATAAATTTAAAATAATAAAACCCAAAATAAATTAAAAATAGTTTTTT
TAATAAAAACATAATAAATAAAAAAAATAATTTCAATTAAGGGTGTATGGGAGGGGCACT
GAATAGAATAACCTCCCAGATTTTTAATGTCTACCAAGGAAGTTAAACCATTGGCAGAAA
AATAAAAAAAAACAACTTTTTTCAGTGCCTTCCCCTCATTTAATTAAAAGTTAATATTTT
TTTTAATTTATAAAAGAACCCAGTAAACAATGTTTTTACATACGGTGTAGAGGGTTACTC
TTAGTTCTTGCTTTTGGATACCTATAATAATTATGATGCAGATGTAAATGCTTTGAATAA
AACTCTCTCAGGTGTTCTTCCTGGTGCAAAAATTTATAAAATTATGAATAACATTTTGAA
CCCAGCTCTTGCTAAAGATATTCTTACTTCTATTACTTTTATTTCTGAGTAAAATAACTT
AAATAGATTGAAATATTCAGTTTAATATGGTAAAATTCTCTCAGTAATAAGATTTTTTAA
ATAATTAATTTGATTTCATTTTTAAATAGATCTTTTGACATCAAATGGACCAAGTAGTGT
TGTTTTCATACCTTTTAAGCTTCCCATTTTGAGAGAAAAGATAAGAGATTTAATTTATAA
GAAAATCCTGCAAAATGGTAACTAAACCCTAGTAGATACAATCGAGGCTGAACAAAAAAT
TGCAGAATTCAAAGAGTTAAACAAAAATTCTAAAGATCCTCTAATGATTGAAATCATTAA
ATTAAAAGGTTATTTAAAAAAAATAATTTTAGATTGAGAAATTAATATTTTTATATTTTA
ATTTAGAAAAAATCGAAATTTAAAATGCTCAAACTAGTGATTAAGCTATTAAAATAGACT
ATGTTAAGGGTATATTAAGATATGATAGCAAATTAAAAGAAGGGTTAGAGGAAATAACTA
TAACACCTAATTATTTTATTGAAAGAACTGTAAAAGGAGTTGATGCTAAGGAGTTCACAG
AAGAGCTTAATGGAGTTTCCTTTAAAAATGTTAAATACACTGGAATTACTAATTCTATAA
TCAATGATATGGGTTTCGTTTTTGCTGGAAAAAATCTCAATAAGGAGAAGTTGTTAGAAT
TATTATACAAGCTAGTCAAGCCAGTAAAATAAATAAATAATTAAATAATTAAATGATAAC
GAAATATTAAAATTCAATTTATAGCTGAATAAGCAAAAGTTAAGATAAAGAAAAGATCTA
ACAGAAGAAGAGATAGTTGACATTTAGTTTAGAAACAGAGGAGAAGGTTTAGAAAATGGT
GAGTTTTATGATGGATAATTTTGGAGAAACATTTAAGGTTTGATTCTACCTCACCATCCA
AGTAATTAATATGAATATTATTTTTTAGAAATTAATAATTAAATAAAATTAGAAAAAGAT
GAATTTATTGAAGAATATTTAAAGTAAGAAGAAGTAAGAATAAACCAAATTAATGAACAG
TTGTAATAAGAATGGGAAACATGGAAATAAGTTTATGATAAGATTCATTTAGACAAGTGA