Identifiers and Description

Gene Model Identifier

TTHERM_00112830

Standard Name

APRO1 (Anaphase promoting 1)

Aliases

PreTt27097 | 8.m00357 | 3812.m02394

Description

Loss of APRO1 results in an arrest of meiosis by the end of prophase with incomplete crossovers and an unusual tandem arrangement of bivalents.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00112830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03935.14.001670058321624e-73hypothetical protein (410 aa)
OxytrichaContig9293.0.g40.0000000000010000211161514907hypothetical protein
Stentor CoeruleusSteCoe_34140.00000011253517471925912

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:35171923: Tian M, Mochizuki K, Loidl J (2022) Arrested crossover precursor structures form stable homologous bonds in a Tetrahymena meiotic mutant. PloS one 17(2):e0263691
  2. Ref:26205990: Hayashi A, Mochizuki K (2015) Targeted Gene Disruption by Ectopic Induction of DNA Elimination in Tetrahymena. Genetics 201(1):55-64
  3. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00112830(coding)
ATGAAAAAATCTTCAAATTAAAATAAAATACATAAGACTTAATTAATGGATTTAGAGTCT
TCTAGAGAAAATTATGTTCAAAAAAGAAGAAAAAGAGCACCTAAGGTTTACAAAAACTAG
GAAGATCTTAACTTAGACTTCTTAGATACTGTCTTAGTGAATAAATAACTATGGAAAGAC
AACTGGCTTGATGGATACTAATACTATATGCTACTTAAAAACTAACACAGATTAGACTAA
AAGTAATTTCCATTGTTGTCATCTCATCCAACTTGGATATATGAAAAACCTATCAATGGA
CATCTCTATTTCCTAAAAGAAGTTGATTTAGAAAAAGATGGTCCATTTAAGCTTGGATTT
CCTAGAACTTCATCATTAAATAAAAAATCATGGAAATGGAAAAGAAATAATTTTCCAACA
AAACTTCCAAAAAATGACCCTAAAATAGTTTATATTTGCGCAACAACTGAAGGCGTGGAA
TCTGATGAAAATGGAAATCTTGTTCAGAAAAGGTTTAGAATGCATATTGCAAAAAAGATA
GATTTATACAATAAAGAGCTACATAATGAAGAAAATTCTCAAGGGTTAGTAGTGTGTTAG
ATGCTTGAAATAGAATTTGGAAAAACAAAAGAAGGGAAGAAATATATCCCAAAACCAATA
AGCTTAATTCGAAAGAAAGAGATCCTGTATAATTAGAAAAAAAAGCAATAAACAGATGAT
GAAGATAAAATAGAATTTGAAGTTGATGATTACTCTCTTGAAAAAAATTCTTTTTAAAGC
CAAAAAAATGAGTTGTAAAATTAAAAAAGCTACAAAAAGTAAAATATTTTTGATAGTAAT
AGAAGCTTCGAATGTGATAAAATTGAAATAGAAAGTAATGTATCTTTAAATAGTAGTGAG
TAGTAATAGGAATAGCCTTAAAGTATTAAAATAGAAAATTAAGTAGATCATATAAGTTCT
ACAGCTGAGTAATGCACTGCTGCTATTTCTATTGAGAATGATAAAATTTTTGAAAAGGCA
TCACCATTTAAAGATTAGCTCTAGATTAATTCTTCATAGGTTTTAGGATCACAGAACCAA
TCTTAAGATGCCTAAAACTATTACCAAAACTTCTTTCATAGCTACACAAAACAAAATAGT
AATGATCCCTTTATTTATTTGAAAAGCTCAATATATTCATCATAAAATAAAAACTTGAAC
CTTATGTAGCATTCCAGTATTTAATTGCTTAAAAATGCTTACTAAAGTAAAAGTGTCAAA
ACTGTGTCTTAAGAGGAGAGCAATAACTCGAATTAAAGAAGTAGTCAGTAAAATATTAAA
TTTAGTAAAAAAACGAGCCCAATAAGAAAAAGACTTTTCTAGAATTATGAAAATAACTCA
TTGTACTAATACTAGGATATTTTTTCTTATTCAAACACATAAAATGGTAATAACAGTCCA
TAAATATCTGATCTTACTTAAAATAATTTTAATATATTTAATGCCTAAAAATATAATATA
TCTTAAACTGCAAACAGAGATAACATTTAAAATATTTACCATAACTCTAACCTCAATAAT
CATAGTTTTAATTGTATTTATGATAGTTTTAAAGGTAATTAAAATAATACAAATTTAGAG
TTTTAAGATTTCATTGAACCTTAAAAGTTTCCTGAATTATCTAACTCCACTGATAAAAAA
ATAGATCAAAATCAAAGAAAATGTGTAAAATAATTCTGTATTTTTGATTAGTTTTAAGAC
TTTGAAGATTTAGAATATTTTCCTCATTCTAAAAATAGCTAATTAGACACTAAATTTAAA
AATTTAGAATTAGAAAATGATGGATTATAAAATAAAAAAAACGCTTTGAAACCCAAAATT
TCATAGGGAGAAAAAGACATTTAATCTACTGAAATTACAATTTTAATTTAACCTGTACAA
TTTAAGTAATGCAAAAAAAATAAAGATGAATACTATGTCATTTTAATTTGA


>TTHERM_00112830(protein)
MKKSSNQNKIHKTQLMDLESSRENYVQKRRKRAPKVYKNQEDLNLDFLDTVLVNKQLWKD
NWLDGYQYYMLLKNQHRLDQKQFPLLSSHPTWIYEKPINGHLYFLKEVDLEKDGPFKLGF
PRTSSLNKKSWKWKRNNFPTKLPKNDPKIVYICATTEGVESDENGNLVQKRFRMHIAKKI
DLYNKELHNEENSQGLVVCQMLEIEFGKTKEGKKYIPKPISLIRKKEILYNQKKKQQTDD
EDKIEFEVDDYSLEKNSFQSQKNELQNQKSYKKQNIFDSNRSFECDKIEIESNVSLNSSE
QQQEQPQSIKIENQVDHISSTAEQCTAAISIENDKIFEKASPFKDQLQINSSQVLGSQNQ
SQDAQNYYQNFFHSYTKQNSNDPFIYLKSSIYSSQNKNLNLMQHSSIQLLKNAYQSKSVK
TVSQEESNNSNQRSSQQNIKFSKKTSPIRKRLFQNYENNSLYQYQDIFSYSNTQNGNNSP
QISDLTQNNFNIFNAQKYNISQTANRDNIQNIYHNSNLNNHSFNCIYDSFKGNQNNTNLE
FQDFIEPQKFPELSNSTDKKIDQNQRKCVKQFCIFDQFQDFEDLEYFPHSKNSQLDTKFK
NLELENDGLQNKKNALKPKISQGEKDIQSTEITILIQPVQFKQCKKNKDEYYVILI


>TTHERM_00112830(gene)
ATGAAAAAATCTTCAAATTAAAATAAAATACATAAGACTTAATTAATGGAGTAATTAATT
TCACATGTAATTTTAATAGTTAATTACTATTATTTTACTAAAAGTTTAGAGTCTTCTAGA
GAAAATTATGTTCAAAAAAGAAGAAAAAGAGCACCTAAGGTTTACAAAAACTAGGAAGAT
CTTAACTTAGACTTCTTAGATACTGTCTTAGTGAATAAATAACTATGGAAAGACAACTGG
CTTGATGGTTTGATTAAATTAAAATTTATTACTTATTTTTCTACATTATTATATAAATAA
TTAAGGATACTAATACTATATGCTACTTAAAAACTAACACAGATTAGACTAAAAGTAATT
TCCATTGTTGTCATCTCATCCAACTTGGATATATGAAAAACCTATCAGTAAGTAAAATAA
TTACTATTAAATTATTAGGTTGTTTTTATTAATTGAAAAAAAAAAATAGATGGACATCTC
TATTTCCTAAAAGAAGTTGATTTAGAAAAAGATGGTCCATTTAAGCTTGGATTTCCTAGA
ACTTCATCATTAAATAAAAAATCATGGAAATGGAAAAGAAATAATTTTCCAACAAAACTT
CCAAAAAATGACCCTAAAATAGTTTATATTTGCGGTAATTCGATTTTAAATCATTTAACA
ATAAATCAATAAAAATTACAGTTAATAAATTTATGATTTTTTTTACTGTTCTTTAATTTA
AAATAGCAACAACTGAAGGCGTGGAATCTGATGAAAATGGAAATCTTGTTCAGAAAAGGT
TTAGAATGCATATTGCAAAAAAGATAGGTGAGTTTTTTTAAAAGTAATATCAATTCTTGG
TTGCTTCATTTATTTTTAAATAGATTTATACAATAAAGAGCTACATAATGAAGAAAATTC
TCAAGGGTTAGTAGTGTGTTAGATGCTTGAAATAGAATTTGGAAAAACAAAAGAAGGGAA
GAAATATATCCCAAAACCAATAAGCTTAATTCGAAAGAAAGAGATCCTGTATAATTAGAA
AAAAAAGCAATAAACAGATGATGAAGATAAAATAGAATTTGAAGTTGATGATTACTCTCT
TGAAAAAAATTCTTTTTAAAGCCAAAAAAATGAGTTGTAAAATTAAAAAAGCTACAAAAA
GTAAAATATTTTTGATAGTAATAGAAGCTTCGAATGTGATAAAATTGAAATAGAAAGTAA
TGTATCTTTAAATAGTAGTGAGTAGTAATAGGAATAGCCTTAAAGTATTAAAATAGAAAA
TTAAGTAGATCATATAAGTTCTACAGCTGAGTAATGCACTGCTGCTATTTCTATTGAGAA
TGATAAAATTTTTGAAAAGGCATCACCATTTAAAGATTAGCTCTAGATTAATTCTTCATA
GGTTTTAGGATCACAGAACCAATCTTAAGATGCCTAAAACTATTACCAAAACTTCTTTCA
TAGCTACACAAAACAAAATAGTAATGATCCCTTTATTTATTTGAAAAGCTCAATATATTC
ATCATAAAATAAGTAATTTAAAATTTTTAATGCCATAATTAAATATTATTAAAAATATTA
AAGAAACTTGAACCTTATGTAGCATTCCAGTATTTAATTGCTTAAAAATGCTTACTAAAG
TAAAAGTGTCAAAACTGTGTCTTAAGAGGAGAGCAATAACTCGAATTAAAGAAGTAGTCA
GTAAAATATTAAATTTAGTAAAAAAACGAGCCCAATAAGAAAAAGACTTTTCTAGAATTA
TGAAAATAACTCATTGTACTAATACTAGGATATTTTTTCTTATTCAAACACATAAAATGG
TAATAACAGTCCATAAATATCTGATCTTACTTAAAATAATTTTAATATATTTAATGCCTA
AAAATATAATATATCTTAAACTGCAAACAGAGATAACATTTAAAATATTTACCATAACTC
TAACCTCAATAATCATAGTTTTAATTGTATTTATGATAGTTTTAAAGGTAATTAAAATAA
TACAAATTTAGAGTTTTAAGATTTCATTGAACCTTAAAAGTTTCCTGAATTATCTAACTC
CACTGATAAAAAAATAGATCAAAATCAAAGAAAATGTGTAATTAATTAATTAACTATTTT
TTTAATTAACATAAAAATTGTGGGATAATTGGATTAAATAATTATTATTAATTAGGTAAA
ATAATTCTGTATTTTTGATTAGTTTTAAGACTTTGAAGATTTAGAATATTTTCCTCATTC
TAAAAATAGCTAATTAGACACTAAATTTAAAAATTTAGAATTAGAAAATGATGGATTATA
AAATAAAAAAAACGCTTTGAAACCCAAAATTTCATAGGGAGAAAAAGACATTTAATCTAC
TGAAATTACAATTTTAATTTAACCTGTACAATTTAAGTAATGCAAAAAAAATAAAGATGA
ATACTATGTCATTTTAATTTGA