Identifiers and Description

Gene Model Identifier

TTHERM_00112440

Standard Name

EBP2 (microtubule-binding protein)

Aliases

PreTt27058 | 8.m00318 | 3812.m02354

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.4%

TetraMine Data

TTHERM_00112440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03970.11.0004659174935984e-170EB1 protein (308 aa)
OxytrichaContig7022.0.g362.0000236365077126e-43Calponin homology (CH) domain
SGDYER016W6.002270911168926e-31BIM1 Microtubule-binding prote
in that together with Kar9p ma
kes up the cortical microtubul
e capture site and delays the
exit from mitosis when the spi
ndle is oriented abnormally
DictyBaseDDB_G02836074.9976494746363024e-29eb1 on chromosome: 4 position
912876 to 914543
WormBaseWBGene000133449.997975313387782e-28locus:ebp-1 status:Partially
_confirmed UniProt:Q9GRZ1
protein_id:CAC14408.1
Stentor CoeruleusSteCoe_290682.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112440(coding)
ATGATGTTTTAAATGAGAATCTATCTAATCACTAAGAGTATTTTAGGTGAACAAATGATT
TATATTTAAATATTATTTGTATTATATTTGATATTATTTATAAAGTTTTCATAAACTAAA
ACAATATACAAAAAAAACAAGTAAAAAACAATTAAAAGCGAAATATTTTACCATTTTTTT
AAGATGAGTGAGGCAATAGGAATTATGGATCCAGCATACTTTGTCAACAAAAATGACATC
CTTAAATGGATTAATAACACACTTAAGCTTAACATAGAAAAAATTGACCATTTAGGTACA
GGAGCAGTTTATTGCTAATTTTTGGATATGATTTATCCTGGATAAGTTTGCATGGGTAAA
GTTAATTGGAAAGCCAAATTAGAATACGAATATCTTAGCAACTTTAAGATTGTTACTAAC
TGTTTGGAGAAAAATGATGTTAAAAAGCACATTGATGTAAATAAGTTAGTAAAATGTAAA
TATCAAGACAATTTGGAATTCGCTTAATGGTTTAAAAAGTTCTTTGATACAAAGTGTGGT
GATAGAAATGCTGATTACGATCCTGAAGCAAGAAGAGCCGTAAAAATCAGTTCTGTTGTT
GAAGTTCCTAAAGTTGCTAGAAAGGAAGAATAGACTAAGTAAAAGACAATAGCAGCATCA
TAACCTTCAACTTAAGCTGCAAATAGTACAGTAAAAAAAGCTACTCCTTCTAAACCTGCA
ACTTCTGCTTTGGCTAACAACAATAAGAGAACTTTAGGTCAAATGTACAATGGCAACTCA
AATGGTAAGCCAGCTCTTCACTCAAATACTAAAACTAATACTAATACTACTGCAGCTCAT
AATCCTTCTAGTAAAGTAACAAATCCTGCTAAAACAGAGAGCAAAGAATACAGTTCTTTA
ATTAATAGCATAAAGGAAATTTTAACTAAGGGAGAATCTGACTAAGAAATTGTTAATAAA
ATTAGAACTCTTGTTAAAGTAGATGTAGCTTAAAAAGAAAATACTGCTATTAAACCAGAA
GAAAAAGAAAATACTGATATTAAGCCAGAAGAAAAAGCTGAATTGCAAAATAGCTCTTAA
ATTAAGTAAATAAGTGACTAATCAATATTCAAGGATACCACAAACACTTCTTTTATCGAA
TAGGAAAATTGA


>TTHERM_00112440(protein)
MMFQMRIYLITKSILGEQMIYIQILFVLYLILFIKFSQTKTIYKKNKQKTIKSEIFYHFF
KMSEAIGIMDPAYFVNKNDILKWINNTLKLNIEKIDHLGTGAVYCQFLDMIYPGQVCMGK
VNWKAKLEYEYLSNFKIVTNCLEKNDVKKHIDVNKLVKCKYQDNLEFAQWFKKFFDTKCG
DRNADYDPEARRAVKISSVVEVPKVARKEEQTKQKTIAASQPSTQAANSTVKKATPSKPA
TSALANNNKRTLGQMYNGNSNGKPALHSNTKTNTNTTAAHNPSSKVTNPAKTESKEYSSL
INSIKEILTKGESDQEIVNKIRTLVKVDVAQKENTAIKPEEKENTDIKPEEKAELQNSSQ
IKQISDQSIFKDTTNTSFIEQEN


>TTHERM_00112440(gene)
AAAATTCATCTTGCAAATCTATAAACCAAATAAATTTTATAATTTTTAATGTAAAAATGA
TTATGTTCATATAAAGTAGACTCGAAAAGTATCAATCGAATCTTAGTTGCTTATCCATAA
AAAAGATAAAAATCACGCCAAATAACAAAATATTTGTTAAAATCCTAGTTATCGTTTGCG
GGGCTTGATGATGTTTTAAATGAGAATCTATCTAATCACTAAGAGTATTTTAGGTGAACA
AATGATTTATATTTAAATATTATTTGTATTATATTTGATATTATTTATAAAGTTTTCATA
AACTAAAACAATATACAAAAAAAACAAGTAAAAAACAATTAAAAGCGAAATATTTTACCA
TTTTTTTAAGATGAGTGAGGCAATAGGAATTATGGATCCAGCATACTTTGTCAACAAAAA
TGACATCCTTAAATGGATTAATAACACACTTAAGGTAGCTTTTTCATTTCTAAAAATATT
TAACTATCTTGTTTAATGATTTAAAACAATAAAAAATGATCCTACAATTTTTGATATTTT
TTATTAACATTTCATTTAAAAAAAAAGCTTAACATAGAAAAAATTGACCATTTAGGTACA
GGAGCAGTTTATTGCTAATTTTTGGATATGATTTATCCTGGATAAGTTTGCATGGGTAAA
GTTAATTGGAAAGCCAAATTAGAATACGAATATCTTAGCAACTTTAAGATTGTTACTAAC
TGTTTGGAGAAAAATGATGTTAAAAAGCACATTGATGTAAATATTATTTTTACTTACAAA
GATTGTCATAATAATCAATACTTAGCCAAAATTTTTATGCTTTATATCATATATTTTTTC
CTAAATAATAGGTAAATAAGTTAGTAAAATGTAAATATCAAGACAATTTGGAATTCGCTT
AATGGTTTAAAAAGTTCTTTGATACAAAGTGTGGTGATAGAAATGCTGATTACGATCCTG
AAGCAAGAAGAGCCGTAAAAATCAGTTCTGTTGTTGAAGTTCCTAAAGTTGCTAGAAAGG
AAGAATAGACTAAGTAAAAGACAATAGCAGCATCATAACCTTCAACTTAAGCTGCAAATA
GTACAGTAAAAAAAGCTACTCCTTCTAAACCTGCAACTTCTGCTTTGGCTAACAACAATA
AGAGAACTTTAGGTCAAATGTACAATGGCAACTCAAATGGTAAGCCAGCTCTTCACTCAA
ATACTAAAACTAATACTAATACTACTGCAGCTCATAATCCTTCTAGTAAAGTAACAAATC
CTGCTAAAACAGAGAGCAAAGAATACAGTTCTTTAATTAATAGCATAAAGGAAATTTTAA
CTAAGGGAGAATCTGACTAAGAAATTGTTAATAAAATTAGAACTCTTGTTAAAGTAGATG
TAGCTTAAAAAGAAAATACTGCTATTAAACCAGAAGAAAAAGAAAATACTGATATTAAGC
CAGAAGAAAAAGCTGAATTGCAAAATAGCTCTTAAATTAAGTAAATAAGTGACTAATCAA
TATTCAAGGATACCACAAACACTTCTTTTATCGAATAGGAAAATTGAATAACCTAAATAA
ATAAATAAACATATATAATATCTTGATAACAAGCAAAAGATTAGCAAAGCCTTTCAAAAT
ATATAGTAAAATAGAATATATAATAGTAGATTTAATTCACTGAACAAAATATTATTAACC
AATTAATTAATTAAACAAATACTAATCATTTGAGTAAATAAATGAATTTAAATCTATATA
TAGCATTAAGAAAGGAATTGAGTAAGTAAATCAAGATGAAGTCAATATAAAAAATACTAA
TAGCTTATTTATAGAGGATTGTACCATCTCACTTTAATTAATTTATAACATAAATTTAAT
ATGCATACCAATCAAATTATAAATGATTAAATTACATTTTATTTTATATTTATGTTTTGG
AGTTTGACAAATTTTTGATGTAGCTTGATTTTTTTTCCTTTCATAATTTTTATTGATTTT
CTATCATCTTAATTTTTTTTATATTTTTATAAGATATTTATTTTTTAT