Identifiers and Description

Gene Model Identifier

TTHERM_00107040

Standard Name

None

Aliases

PreTt23098 | 7.m00547

Description

TPR Domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01535 ) PPR repeat
  • ( PF05406 ) WGR domain
  • ( PF00069 ) protein kinase domain
  • ( PF00961 ) LAGLIDADG endonuclease
  • ( PF07714 ) protein tyrosine kinase
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF00633 ) Helix-hairpin-helix motif
  • ( TIGR01393 ) GTP-binding protein LepA
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR02480 ) flagellar motor switch protein FliN
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein
  • ( PF06034 ) Nucleopolyhedrovirus protein of unknown function

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00107040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04917.19.997093137033517e-262hypothetical protein (1302 aa)
DictyBaseDDB_G02927146.99868990988981e-32DDB_G0292714 on chromosome: 6
position 1780390 to 1784905
Stentor CoeruleusSteCoe_382241.462486227251231e-31
WormBaseWBGene000022157.002638123733849e-21locus:klc-2 Kinesin light ch
ain status:Confirmed UniPr
ot:P46822 protein_id:CCD6511
3.1
OxytrichaContig528.1.g1230.00000000000020009182674645818Clustered mitochondria
SGDYKL161C0.0000000400154582995175KDX1 Protein kinase implicated
in the Slt2p mitogen-activate
d (MAP) kinase signaling pathw
ay; interacts with numerous co
mponents in the mating pheromo
ne and CWI MAPK pathways; asso
ciates with Rlm1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00107040(coding)
ATGCTTACCTAAGTTATGCAACAAGAACTTACTTTGTTGACTAAGTAGCAAGTAAGCTTC
AAAGATGACTAAAACCAGGATGTATCCAAAATGTAAAAAACTCTTTCGAAATAGTAAAAT
GATAATAGAAACTAATAAAAGAGTTCGATTCCGCTAATCTATCGCCAATATTAGTCTGCT
AAAGATATAAGGAAAGAAGGAAATTTAGTGAATTTGTTGACAACTCAAGAAGATGACTAT
GAAAATTGTATGCTAAAAAAAGAAGAGAAGAAATCTCCTTACTCTCCTGGGTCTTCTGAT
GATGAACCTCCACAAAAGATCCAAAGAGATGAAGTGAGTGAAAAGAACGACGAATACTCT
TAAAAGACAGATAATTGGCTCAGGGATTAGCTGAATAAGTCAATATAACTCTAAGAAATC
AGTCAGAGAAAAGATATTTAAGGCTAACTTGAAGAAAAAGAAGAAGAGAAAAACGATATT
TAAAGCCAAGATAGCATTCAAAACATGTACTTCAAAACTTAAAATAGTGAGATAGAGAAA
ATTGGATTCAAATCATAAAGTTAGAAAATTTACGAATTTATCATTGAAATTAATTTGTCT
GATTATCTGGCTCAAAGCTAACTAACTCTAAGCGAGTTAAATTAAATTTATAATGACTTT
TTAAATGTTAAGTTGAATGATGACAAAGCTACTAGTTGCAAGTTAATGATTATACTAATT
GAACTATACTCCAAGTCTTATAGAGTCAAAAAGGTTATATGCAGACATGGGGTTTCTGAA
TTTGTGATGGCTGGATACAATATTAAAACAAAAGCAGAAGTCGCTATTTTTGTACAACTT
CCTTAGTTCAATGCCCAAAAAGGAAATTGCTTTGAAAAATTTAAATAAGAGCAAGAATAA
GTCCTTTAAAAAATCATAAGCGAGCAGTTTAAGCTTGATCAGATTAACCATAACTATTAC
ATCTTAAAAGTCTTTTAGTAATTCTTAATAGAGCCTGTTCTAGGTTTGGTTTAAATCACT
GAGATATTTGAATGCGATTTAGAATCAGAAATTAAGTTGTAATAGAAAGATTTCACTAAT
TAGAATTTAATTAATATTTTCTTTTAGCTTATCAATGCTCTAACAGAAATACATTCTAAT
GATATTACCCACCTATAACTAAATCCCAGAAATATTTTAAAAATGTAAAACGGATAATAC
AAACTATCAAATTTTGGTAGATTTTCATTAATTTCATCAAATTAAAAAATCTCATAAGAG
GAAATCAAGTTTTACTCTCCAGAATAAATGGAATGCATTAAAAATTAAACTTCTGTACTA
AAAATGTAAGATAAATCTGATGTTTACAGCATGGGTCTCACATTAATGACTTTGTTTAAT
TTACCATAAGATAAATTTTCAATAAGCGATATTAGGGAAGGTAAATTCTTAGAATAAAAA
ATTGATGATCCTGTTTAACTTTCTCTTATGATGTTTATCAAATATTATATGACTTGCAAG
GATCCTAATAATAGATTTAATTCTCTTAAATTAAGAGCGATTTTACTTAGCGAGTTTTCA
AAGTAATAGATCAACAGAGAATAAGAATATCTTAGAATTGTTAAACTGATTTCGAGCTAC
AAAGCTTAAAATCTACACACTCATAAATACCTTTCATATTTATATTTTTTAACAGCTCAA
TTAAATAAAAATCCTGGAAATAATTTGATTTAGTCTATAAAAATAGCTCAGCTAAACACT
AATTTTAACAATTCAGATTTTTTGTAAATTTAAAGTATGTATGCTCTTATTTTAAGTAGC
GAACACAGATTTAAAGAATCTGATAAAATATTAACCAATTGCTTAAGTTAAAGAAAGCAA
TTATATAAAGACTAACTTCACTATGATATCTCTGATGCTATAAATAGTTTTGCAATTTCG
TATACAACTTAAGAAGAATATAAACTGGCCCTCGAGTAGGATTTAAAAACATTAGAGTTG
AGAGAAAGCTTATATGGCATGGAGCATCCTGAAATTATTAGGTCTTATCTTAATATCGCA
TCAACATATGAAAAGCTTGTCCAACACAAAAAAGCTTTGGAATATAAACTAAAAGCTTTG
AATATGAGAGAATAAATAAATACTGGAAATCACCCAGACTTAATTGAGATTTTTAATTCA
TTAGCATAAACATACGAAGTGCTAGGAGACAATAAAACAGCTTAACAATATGATTTTAAG
GCTGTTAAAATGAGAGAAGCTCTATAGAATGATGAACCCTCCAAACTTGCATAGTCTTAT
TGCAGAATTGCAGTTTCATATGAAAGACTTGGAGATGACAAAACATCCCTCGAATATAAA
CTCAAAGCCTTAAAAATTAGGGAGACTCTATTCTAAGGTAATCACCATGATCTTGCTTTT
TCCTTAAACAGTGTAGCTATTTCATATGAAAGATTGGGAAACTACAAAGAAGCTCAAGAT
TATTTCTTAAGAGCTTTGAAAATGAGGGAAGCACTTTATCACGGTAAACATCCTGACCTT
GCAGAATCCTATAACAGTATTGCTGCTTTCTATTCGAGACAGGGAGATTATTCTAAAGCC
TTAGACTATGAATTAAAATCACTTTACATTAGAGAAATCCTCTATTTAAAAAACCATCCA
GACATAGCTGAGTCTTTAAACAATGTTGCTGTTGCCTATGAAAAATTAGGATTCGATGAG
GTCGCCCAAGAATATGATTTATAAGCCATGAAAATGAGAGAAGCTCTTTACAATCAAGAT
CACCCTGAACTTGCACAATCTTACAGTAATATGGGAGTCTGTTATGAGAGATAGAGGAAT
TACTAAAAGGCTTTGGAGTATGAAAAAAAGGCTTTAAAAATGAGATCAAGACTATATGAG
GGAGATCATCCTGATGTAGCTGAATCCTATAATAATCTAGGAATTTGCTATGAAAGAATA
GGAAGTGATAAGAAAGCTTTGGAACTTAAGATAAAATCTTTGCAAATGAGAGAAAGAATA
TACAAACAAGAGCATGCTGACGTAGCTGAATCATTAAACAGTGTTGCTATTTCTTATGGA
AGAATAGGAGAAAATCAAAAAGCTTTAGAACATAAACTAAAGGCTCTAGAAATTAGAAAA
AAGATCTACTAAGACAATCATCCTGAAATCGCTGAATCTCTCAGTAGTATTGCAGTAACT
TATGAAAAACTGGGTGATGAAGAAAAAGCTTATGAATATGATTAAAAGGCTTTGGAGATG
AGAATTAAAGTTTATCAAACAGAACAGCATCCTGAAGTAGCTGATTCATATTAAAATCTT
GCTATTTATTATAGCAGAAAAGGTGATCATCAAACATCGCTGGCCTATAAACTAAAATCT
TTGACCATCAGAAAGTCTCTGTACAATGATGAGAAAAACTCTGATATTGCAAAGCAACTA
AACAGCGTTGCAGTTACCTATTAAAAGCTAGGTAACAGAAAATTTGCTCTAGATTTCTTC
TTAAAAGCTTTGAAAGTAAGAGAAGATCTGTTCTCTGGAAACCATCCTGACCTAGTCGAG
TCATATAGTAATTTAGCAAATTTCTTTTAAGAAGAAGGCGACAGCATTAAATAGTAAGAA
TATGAGTAAAAACTTAAATTGTTAAATATAAATTTACTAAGTTAAATCACTTAAGAATTG
AACCTATGTCTATGA


>TTHERM_00107040(protein)
MLTQVMQQELTLLTKQQVSFKDDQNQDVSKMQKTLSKQQNDNRNQQKSSIPLIYRQYQSA
KDIRKEGNLVNLLTTQEDDYENCMLKKEEKKSPYSPGSSDDEPPQKIQRDEVSEKNDEYS
QKTDNWLRDQLNKSIQLQEISQRKDIQGQLEEKEEEKNDIQSQDSIQNMYFKTQNSEIEK
IGFKSQSQKIYEFIIEINLSDYLAQSQLTLSELNQIYNDFLNVKLNDDKATSCKLMIILI
ELYSKSYRVKKVICRHGVSEFVMAGYNIKTKAEVAIFVQLPQFNAQKGNCFEKFKQEQEQ
VLQKIISEQFKLDQINHNYYILKVFQQFLIEPVLGLVQITEIFECDLESEIKLQQKDFTN
QNLINIFFQLINALTEIHSNDITHLQLNPRNILKMQNGQYKLSNFGRFSLISSNQKISQE
EIKFYSPEQMECIKNQTSVLKMQDKSDVYSMGLTLMTLFNLPQDKFSISDIREGKFLEQK
IDDPVQLSLMMFIKYYMTCKDPNNRFNSLKLRAILLSEFSKQQINREQEYLRIVKLISSY
KAQNLHTHKYLSYLYFLTAQLNKNPGNNLIQSIKIAQLNTNFNNSDFLQIQSMYALILSS
EHRFKESDKILTNCLSQRKQLYKDQLHYDISDAINSFAISYTTQEEYKLALEQDLKTLEL
RESLYGMEHPEIIRSYLNIASTYEKLVQHKKALEYKLKALNMREQINTGNHPDLIEIFNS
LAQTYEVLGDNKTAQQYDFKAVKMREALQNDEPSKLAQSYCRIAVSYERLGDDKTSLEYK
LKALKIRETLFQGNHHDLAFSLNSVAISYERLGNYKEAQDYFLRALKMREALYHGKHPDL
AESYNSIAAFYSRQGDYSKALDYELKSLYIREILYLKNHPDIAESLNNVAVAYEKLGFDE
VAQEYDLQAMKMREALYNQDHPELAQSYSNMGVCYERQRNYQKALEYEKKALKMRSRLYE
GDHPDVAESYNNLGICYERIGSDKKALELKIKSLQMRERIYKQEHADVAESLNSVAISYG
RIGENQKALEHKLKALEIRKKIYQDNHPEIAESLSSIAVTYEKLGDEEKAYEYDQKALEM
RIKVYQTEQHPEVADSYQNLAIYYSRKGDHQTSLAYKLKSLTIRKSLYNDEKNSDIAKQL
NSVAVTYQKLGNRKFALDFFLKALKVREDLFSGNHPDLVESYSNLANFFQEEGDSIKQQE
YEQKLKLLNINLLSQITQELNLCL


>TTHERM_00107040(gene)
ATGCTTACCTAAGTTATGCAACAAGAACTTACTTTGTTGACTAAGTAGCAAGTAAGCTTC
AAAGATGACTAAAACCAGGATGTATCCAAAATGTAAAAAACTCTTTCGAAATAGTAAAAT
GATAATAGAAACTAATAAAAGAGTTCGATTCCGCTAATCTATCGCCAATATTAGTCTGCT
AAAGATATAAGGAAAGAAGGAAATTTAGTGAATTTGTTGACAACTCAAGAAGATGACTAT
GAAAATTGTATGCTAAAAAAAGAAGAGAAGAAATCTCCTTACTCTCCTGGGTCTTCTGAT
GATGAACCTCCACAAAAGATCCAAAGAGATGAAGTGAGTGAAAAGAACGACGAATACTCT
TAAAAGACAGATGTAAGAATACTTTGTCAAAACTTTTTCTAATAATATATTTTTACTATA
TGTAGAATTGGCTCAGGGATTAGCTGAATAAGTCAATATAACTCTAAGAAATCAGTCAGA
GAAAAGATATTTAAGGCTAACTTGAAGAAAAAGAAGAAGAGAAAAACGATATTTAAAGCC
AAGATAGCATTCAAAACATGTACTTCAAAGTAAGTTTTAATTTATTTTACATTTACAAAA
ATTCAGGATAGTAATAACTCTTTATAAAAAAGACTTAAAATAGTGAGATAGAGAAAATTG
GATTCAAATCATAAAGTTAGAAAATTTACGAATTTATCATTGAAATTAATTTGTCTGATT
ATCTGGCTCAAAGCTAACTAACTCTAAGCGAGTTAAATTAAATTTATAATGACTTTTTAA
ATGTTAAGTTGAATGATGACAAAGCTACTAGTTGCAAGTTAATGATTATACTAATTGAAC
TATACTCCAAGTCTTATAGAGTCAAAAAGGTTATATGCAGACATGGGGTTTCTGAATTTG
TGATGGCTGGATACAATATTAAAACAAAAGCAGAAGTCGCTATTTTTGTACAACTTCCTT
AGTTCAATGCCCAAAAAGGAAATTGCTTTGAAAAATTTAAATAAGAGCAAGAATAAGTCC
TTTAAAAAATCATAAGCGAGCAGTTTAAGCTTGATCAGATTAACCATAACTATTACATCT
TAAAAGTCTTTTAGTAATTCTTAATAGAGCCTGTTCTAGGTTTGGTTTAAATCACTGAGA
TATTTGAATGCGATTTAGAATCAGAAATTAAGTTGTAATAGAAAGATTTCACTAATTAGA
ATTTAATTAATATTTTCTTTTAGCTTATCAATGCTCTAACAGAAATACATTCTAATGATA
TTACCCACCTATAACTAAATCCCAGAAATATTTTAAAAATGTAAAACGGATAATACAAAC
TATCAAATTTTGGTAGATTTTCATTAATTTCATCAAATTAAAAAATCTCATAAGAGGAAA
TCAAGTTTTACTCTCCAGAATAAATGGAATGCATTAAAAATTAAACTTCTGTACTAAAAA
TGTAAGATAAATCTGATGTTTACAGCATGGGTCTCACATTAATGACTTTGTTTAATTTAC
CATAAGATAAATTTTCAATAAGCGATATTAGGGAAGGTAAATTCTTAGAATAAAAAATTG
ATGATCCTGTTTAACTTTCTCTTATGATGTTTATCAAATATTATATGACTTGCAAGGATC
CTAATAATAGATTTAATTCTCTTAAATTAAGAGCGATTTTACTTAGCGAGTTTTCAAAGT
AATAGATCAACAGAGAATAAGAATATCTTAGAATTGTTAAACTGATTTCGAGCTACAAAG
CTTAAAATCTACACACTCATAAATACCTTTCATATTTATATTTTTTAACAGCTCAATTAA
ATAAAAATCCTGGAAATAATTTGATTTAGTCTATAAAAATAGCTCAGCTAAACACTAATT
TTAACAATTCAGATTTTTTGTAAATTTAAAGTATGTATGCTCTTATTTTAAGTAGCGAAC
ACAGATTTAAAGAATCTGATAAAATATTAACCAATTGCTTAAGTTAAAGAAAGCAATTAT
ATAAAGACTAACTTCACTATGATATCTCTGATGCTATAAATAGTTTTGCAATTTCGTATA
CAACTTAAGAAGAATATAAACTGGCCCTCGAGTAGGATTTAAAAACATTAGAGTTGAGAG
AAAGCTTATATGGCATGGAGCATCCTGAAATTATTAGGTCTTATCTTAATATCGCATCAA
CATATGAAAAGCTTGTCCAACACAAAAAAGCTTTGGAATATAAACTAAAAGCTTTGAATA
TGAGAGAATAAATAAATACTGGAAATCACCCAGACTTAATTGAGATTTTTAATTCATTAG
CATAAACATACGAAGTGCTAGGAGACAATAAAACAGCTTAACAATATGATTTTAAGGCTG
TTAAAATGAGAGAAGCTCTATAGAATGATGAACCCTCCAAACTTGCATAGTCTTATTGCA
GAATTGCAGTTTCATATGAAAGACTTGGAGATGACAAAACATCCCTCGAATATAAACTCA
AAGCCTTAAAAATTAGGGAGACTCTATTCTAAGGTAATCACCATGATCTTGCTTTTTCCT
TAAACAGTGTAGCTATTTCATATGAAAGATTGGGAAACTACAAAGAAGCTCAAGATTATT
TCTTAAGAGCTTTGAAAATGAGGGAAGCACTTTATCACGGTAAACATCCTGACCTTGCAG
AATCCTATAACAGTATTGCTGCTTTCTATTCGAGACAGGGAGATTATTCTAAAGCCTTAG
ACTATGAATTAAAATCACTTTACATTAGAGAAATCCTCTATTTAAAAAACCATCCAGACA
TAGCTGAGTCTTTAAACAATGTTGCTGTTGCCTATGAAAAATTAGGATTCGATGAGGTCG
CCCAAGAATATGATTTATAAGCCATGAAAATGAGAGAAGCTCTTTACAATCAAGATCACC
CTGAACTTGCACAATCTTACAGTAATATGGGAGTCTGTTATGAGAGATAGAGGAATTACT
AAAAGGCTTTGGAGTATGAAAAAAAGGCTTTAAAAATGAGATCAAGACTATATGAGGGAG
ATCATCCTGATGTAGCTGAATCCTATAATAATCTAGGAATTTGCTATGAAAGAATAGGAA
GTGATAAGAAAGCTTTGGAACTTAAGATAAAATCTTTGCAAATGAGAGAAAGAATATACA
AACAAGAGCATGCTGACGTAGCTGAATCATTAAACAGTGTTGCTATTTCTTATGGAAGAA
TAGGAGAAAATCAAAAAGCTTTAGAACATAAACTAAAGGCTCTAGAAATTAGAAAAAAGA
TCTACTAAGACAATCATCCTGAAATCGCTGAATCTCTCAGTAGTATTGCAGTAACTTATG
AAAAACTGGGTGATGAAGAAAAAGCTTATGAATATGATTAAAAGGCTTTGGAGATGAGAA
TTAAAGTTTATCAAACAGAACAGCATCCTGAAGTAGCTGATTCATATTAAAATCTTGCTA
TTTATTATAGCAGAAAAGGTGATCATCAAACATCGCTGGCCTATAAACTAAAATCTTTGA
CCATCAGAAAGTCTCTGTACAATGATGAGAAAAACTCTGATATTGCAAAGCAACTAAACA
GCGTTGCAGTTACCTATTAAAAGCTAGGTAACAGAAAATTTGCTCTAGATTTCTTCTTAA
AAGCTTTGAAAGTAAGAGAAGATCTGTTCTCTGGAAACCATCCTGACCTAGTCGAGTCAT
ATAGTAATTTAGCAAATTTCTTTTAAGAAGAAGGCGACAGCATTAAATAGTAAGAATATG
AGTAAAAACTTAAATTGTTAAATATAAATTTACTAAGTTAAATCACTTAAGAATTGAACC
TATGTCTATGA