Identifiers and Description

Gene Model Identifier

TTHERM_00106970

Standard Name

None

Aliases

PreTt23091 | 7.m00540

Description

Kelch motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00435 ) Spectrin repeat
  • ( PF00643 ) B-box zinc finger
  • ( PF01344 ) kelch repeat protein
  • ( PF07646 ) kelch repeat protein
  • ( PF04640 ) Protein of unknown function, DUF597
  • ( PF00097 ) zinc finger, C3HC4 type (RING

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00106970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00424.19.997093137033517e-262kelch domain-containing protei
n family protein (709 aa)
OxytrichaContig6810.0.g758.997297067630326e-99Kelch motif
Stentor CoeruleusSteCoe_30441.6458114310822737e-38
WormBaseWBGene000161910.00000000019994075865167896status:Confirmed UniProt:Q8M
QB4 protein_id:CCD63333.1
DictyBaseDDB_G02713720.0000000029989608248573072DDB_G0271372 on chromosome: 2
position 117705 to 120704

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00106970(coding)
ATGGAGTGTCCCATGTGCTATATACTATATGATGAGAAAAAGCATATTCCTAGAAATTTA
CCTTGTGGCCACACATTCTGCGAGTTATGTTTGTAGTAAATTTTATAGCCAAAAGGATTT
ATTGAGTGTCCAAGCTGTAGGAAAAAATTGAGTCCAGATGTACGTCCTGAATCACTTTCA
AAGAATTTTATAGCACTTGATTTAGCTTTGAAATAACATCAGCTTTAATCTAAATTATAA
TTATGTGATACACATTAGGAGTTTTAATTATTCTTTTGCGAGGATTGTTAGGAACATTTA
TGCACTTAGTGTATCATAAATCATTCTGGTCATAAATTTGTAAAATAAGAGCATTCAGTT
TCTCTTTTAAAAGAAAGGCTACAGAAAGCAAAAGACCAGTTGAATGATATCATGGATACA
GTCAATTCAGCAATTTAGAATGCAACAGAAATCAAAACATATTAAGAGAAATATTTAAAG
GAATAATTATAGTTAATTGATAGCGAATTCGATTCACTCATCGAAAAGATAAATTAAAAA
AGAGAATCTTTTAAGAAAGAATACTCACATATATACATGGAATACATACAATCATTAGAG
TTAGATATAGTACTTCATTAAAGTGTCAGTGACTAATTTATAGCTAACTCTAATACCATT
TAAGAAACTGAGAAATTATTAGAATAAACAAAGGTAATAAAGAATGATCAATTAGTCAAC
AAAATATCTGAAATTGAGGATTAAATTAAAAAGTAGATAAAGGAAAGCACAATAAGCTAA
GAAAAGCAAGAATTCGAAATTCCATCTATAGTCTTTGGTAGTGATATATACAAATCGATC
AGTAGCATTGCCTATCTAGATGTTTACCAGCCAAAAATATGTTTCGTTGGTAATAAAAAT
AAGTTGATCATCTTAGATTTAAAGAAATTTGAGTGGAAAAAATATAATCTTGAAGGAGTT
AAGTTCTTGGGGTACAGTTCTGCTGTGACTTTAAGAAATGACAATTTATTACTTATGGGT
GGTGGAAATTCTGATTAGGTTTATGAAATCAGTATATAGAATGATTTGCAAGTAATCAAA
AGACAATAAATGCCAATAGCTCGCAAAGAACACTGCTCAGTTGTTTTAAATGATGGAAGT
GTAATGATTATGGGAGGATATAACATGGAGGCATAAAAGATGCTTAATAGTTGCTATTTA
TATATCCCTAAAATTGATTAGTGGAGTGAACTTGCTCCCATGAAAATTCCAAAATGTGCT
TTTGCAGCCTCATTGTGTAGTTATGGGAAATACGTTTACACATTTGGTGGGTATGATAGC
CAAAAAAGATTAAATGACATTGAAAAATACACAATTTCAACAAATACTTGGGAAATTATC
AATTTTAAGCTTCCAAAGCATTTGAGCAACTGTGCTGCTATCCATCATCCGAGATATGCT
TCAAAAGATTGCATATATATTCTTGGAGGAGGCCATGATGAAGGTTTTTTAAAGGAAGTT
TACAAATTTACTACAAGTCCTGAACATAAAATAGAGGTCATAGCAGAGATGGAAAACGGT
AAAGATTTGAGAAACAAGGTAGTATTATCTAAGCATCATCTCTATACTATTGGAGGTAAT
GGGTATAAATGCGAGAGGCTCAATCTTATTAGTAAAGTTTGGGACACTCTACCTTCTTAT
TACCCAAATGTAGTAGATAATCTAGATAGCTGGGCATGCGCTCTAACATATACTAATCAA
TCGGCTGATGATATGCTTAGTAGTTCGATTATGTTGGACGATCCAAACATCAAAAGCATT
AAGAGCAACTAAAGCTAATCCTATCAATAGCAAAATGAATACAATTTTTATAGAAATAGA
GCTTAATTTTTATAATACTAGAACGTGAATGAATAGATTAATCCCTACGTTTTATAAAAT
AATGTTTCATTTGCAAATAATATTGGTTATGATTAAGATGATCATCATGAGTAAAGAGAG
GATAATATACTAAACTATTCGTTTAATTAAAATCATAGTTAATTTAGAGAAGAGCTGCAA
TCAAGCTCTAATTTCTACAATTACCGTTACAATTTCATGATGGATTGA


>TTHERM_00106970(protein)
MECPMCYILYDEKKHIPRNLPCGHTFCELCLQQILQPKGFIECPSCRKKLSPDVRPESLS
KNFIALDLALKQHQLQSKLQLCDTHQEFQLFFCEDCQEHLCTQCIINHSGHKFVKQEHSV
SLLKERLQKAKDQLNDIMDTVNSAIQNATEIKTYQEKYLKEQLQLIDSEFDSLIEKINQK
RESFKKEYSHIYMEYIQSLELDIVLHQSVSDQFIANSNTIQETEKLLEQTKVIKNDQLVN
KISEIEDQIKKQIKESTISQEKQEFEIPSIVFGSDIYKSISSIAYLDVYQPKICFVGNKN
KLIILDLKKFEWKKYNLEGVKFLGYSSAVTLRNDNLLLMGGGNSDQVYEISIQNDLQVIK
RQQMPIARKEHCSVVLNDGSVMIMGGYNMEAQKMLNSCYLYIPKIDQWSELAPMKIPKCA
FAASLCSYGKYVYTFGGYDSQKRLNDIEKYTISTNTWEIINFKLPKHLSNCAAIHHPRYA
SKDCIYILGGGHDEGFLKEVYKFTTSPEHKIEVIAEMENGKDLRNKVVLSKHHLYTIGGN
GYKCERLNLISKVWDTLPSYYPNVVDNLDSWACALTYTNQSADDMLSSSIMLDDPNIKSI
KSNQSQSYQQQNEYNFYRNRAQFLQYQNVNEQINPYVLQNNVSFANNIGYDQDDHHEQRE
DNILNYSFNQNHSQFREELQSSSNFYNYRYNFMMD


>TTHERM_00106970(gene)
ATGGAGTGTCCCATGTGCTATATACTATATGATGAGAAAAAGCATATTCCTAGAAATTTA
CCTTGTGGCCACACATTCTGCGAGTTATGTTTGTAGTAAATTTTATAGCCAAAAGGATTT
ATTGAGTGTCCAAGCTGTAGGAAAAAATTGAGTCCAGATGTACGTCCTGAATCACTTTCA
AAGAATTTTATAGCACTTGATTTAGCTTTGAAATAACATCAGCTTTAATCTAAATTATAA
TTATGTGATACACATTAGGAGTTTTAATTATTCTTTTGCGAGGATTGTTAGGAACATTTA
TGCACTTAGTGTATCATAAATCATTCTGGTCATAAATTTGTAAAATAAGAGCATTCAGTT
TCTCTTTTAAAAGAAAGGCTACAGAAAGCAAAAGACCAGTTGAATGATATCATGGATACA
GTCAATTCAGCAATTTAGAATGCAACAGAAATCAAAACATATTAAGAGAAATATTTAAAG
GAATAATTATAGTTAATTGATAGCGAATTCGATTCACTCATCGAAAAGATAAATTAAAAA
AGAGAATCTTTTAAGAAAGAATACTCACATATATACATGGAATACATACAATCATTAGAG
TTAGATATAGTACTTCATTAAAGTGTCAGTGACTAATTTATAGCTAACTCTAATACCATT
TAAGAAACTGAGAAATTATTAGGTAATTATCACATAATGAAGACATAAAATATATTAAAT
TTATAAATAAATATCTTACAAATATTAAATAATTATTTTGTATTAACAACAAATAGAATA
AACAAAGGTAATAAAGAATGATCAATTAGTCAACAAAATATCTGAAATTGAGGATTAAAT
TAAAAAGTAGATAAAGGAAAGCACAATAAGCTAAGAAAAGCAAGAATTCGAAATTCCATC
TATAGTCTTTGGTAGTGATATATACAAATCGATCAGTAGCATTGCCTATCTAGATGGTAT
AAATATATATTTTAAATTTATTTATTAGCTTTATTAATAAATATAAATTCGCTTTTAAAA
AATTTATATCTGTACAGAATTCATTTTTATTATGAAAAACAAACTTAATTTTTTTAATAA
AAGTTTACCAGCCAAAAATATGTTTCGTTGGTAATAAAAATAAGTTGATCATCTTAGATT
TAAAGAAATTTGAGTGGAAAAAATATAATCTTGAAGGAGTTAAGTTCTTGGGGTACAGTT
CTGCTGTGACTTTAAGAAATGACAATTTATTACTTATGGGTGGTGGAAATTCTGATTAGG
TTTATGAAATCAGTATATAGAATGATTTGCAAGTAATCAAAAGACAATAAATGCCAATAG
CTCGCAAAGAACACTGCTCAGTTGTTTTAAATGATGGAAGTGTAATGATTATGGGAGGAT
ATAACATGGAGGCATAAAAGATGCTTAATAGTTGCTATTTATATATCCCTAAAATTGATT
AGTGGAGTGAACTTGCTCCCATGAAAATTCCAAAATGTGCTTTTGCAGCCTCATTGTGTA
GTTATGGGAAATACGTTTACACATTTGGTGGGTATGATAGCCAAAAAAGATTAAATGACA
TTGAAAAATACACAATTTCAACAAATACTTGGGAAATTATCAATTTTAAGCTTCCAAAGC
ATTTGAGCAACTGTGCTGCTATCCATCATCCGAGATATGCTTCAAAAGATTGCATATATA
TTCTTGGAGGAGGCCATGATGAAGGTTTTTTAAAGGAAGTTTACAAATTTACTACAAGTC
CTGAACATAAAATAGAGGTCATAGCAGAGATGGAAAACGGTAAAGATTTGAGAAACAAGG
TAGTATTATCTAAGCATCATCTCTATACTATTGGAGGTAATGGGTATAAATGCGAGAGGC
TCAATCTTATTAGTAAAGTTTGGGACACTCTACCTTCTTATTACCCAAATGTAGTAGATA
ATCTAGATAGCTGGGCATGCGCTCTAACATATACTAATCAATCGGCTGATGATATGCTTA
GTAGTTCGATTATGTTGGACGATCCAAACATCAAAAGCATTAAGAGCAACTAAAGCTAAT
CCTATCAATAGCAAAATGAATACAATTTTTATAGAAATAGAGCTTAATTTTTATAATACT
AGAACGTGAATGAATAGATTAATCCCTACGTTTTATAAAATAATGTTTCATTTGCAAATA
ATATTGGTTATGATTAAGATGATCATCATGAGTAAAGAGAGGATAATATACTAAACTATT
CGTTTAATTAAAATCATAGTTAATTTAGAGAAGAGCTGCAATCAAGCTCTAATTTCTACA
ATTACCGTTACAATTTCATGATGGATTGA