Identifiers and Description

Gene Model Identifier

TTHERM_00106910

Standard Name

None

Aliases

PreTt23085 | 7.m00534

Description

C3HC4 type (RING finger) zinc finger protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00106910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00411.19.997093137033517e-262hypothetical protein (566 aa)
OxytrichaContig18265.0.g586.998542127613979e-20Ring finger domain
DictyBaseDDB_G02897190.0000000029989608248573072DDB_G0289719 on chromosome: 5
position 3159163 to 3163422
SGDYLR247C0.00000019998969434520019IRC20 Putative helicase; local
izes to the mitochondrion and
the nucleus; YLR247C is not an
essential gene; null mutant d
isplays increased levels of sp
ontaneous Rad52p foci
WormBaseWBGene000171440.00020003864201578029Uncharacterized RING finger pr
otein EEED8.16 status:Confir
med UniProt:Q95QN6 protein
_id:CCD68743.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00106910(coding)
ATGCGTTAGTTAAGAAACTAAAGATCATAGCAAGATTAAGGATTTTCATTTTAGTCTAAT
CCACTTCCCAGTAATAATAAGTTTGATAAAAATTAAGAAGAAAGCAAATGTGAATAATAT
TGCATGAGCTAAAGAGATATTGAAGGGTTTAATACTGATTTGAATATTTTCACTGCAAAA
TATAAAGTATATGAGAATGTAGATTTTTCTTCTCCATCTTTTTACAAAAAAAAACATATT
TTGAGTGATGTGTAAGAAAAAGAAAATGAATTTTTAAATCAAATAAGTGACCAAAAAAGT
CAGCATTCATATGGAAATAATTTAGATGAGTATAATATAGTTAAATCAAGCTACAGCTTG
AACTCTCACAACTCTTAAAAACAGCAAAATCAAGTATATGAGAGTGAAAGAAAGCCTATT
TTTGGACCTTTTACAATTACTTAAAAAGAAATTTTTAGTAATCATAATAGCAAAAGTAAA
AACTAAGAATAAAAGAGTCTTTATGAATCAATAGAATATACAAGAAGGAATCCTTTTAGT
TTTGAAAAAAATTAAATATAAGATAATTAAATAAGTGAAATTAAAAATGTGCCAAAAAAG
AGAGAAATGAGTGTAGAACAAGAGTATGGCTAGGTTGTAAATAAGACTAAATATAATTAA
ACAAATAAATAACAACTAAATAATAATGATTTTGATTTTAGTGATCATAAAGACAAATCA
CATAAAAATGTTTTTGATGATAATTAAGAATATTTTGGTTTTAAAAATATGAATTAAGAA
AACAAAATTTATGAAACACCAAACAACTTTGAATAAAAAAGAAAAGGAAAATATAGAGCT
CGAATAATAGATTCATCAAGTGCAAAGTAGTAGAACTTTAATCAGAATAGTAATTAATCA
TGTACCTTCAAAAATTTAAATAAATAAATAGATCTAAATAATATAATTTAAAATCCTTCA
TCGAAGAGAAGACTAACAAGGTCTACTAATATTCTTCATGAATCCTTTCAAAAACAAATT
TTCTAGAGGTAGGAATCATTAAATTAAAATAAAAGAATGAGAAATTCTAATAATAAGAAT
GAAATGAAAGATGAAAGGAATTAGACTTGCATAAATAAAACAAAGTAAGAAGAGTCTAAG
AAGTTAAAAAAATTGGTAAAAAATAAAAGAAAATCAGAAGGAAAGAACGAATCGTTAACT
TAAAAGTAAAATCTAATGTCATAGCAACTCAAAAATTGTGCAATTTGTTTGGGAATACCA
GAAGATAGTATATATGGAGTTGTTTAATGTTAGCATGAATTTTGCATTGATTGCATTCTA
CAGTGGTCTGAAGTAACTAATTTGTGTCCTATGTGCAGAGCAGAATTCAGCAAAATATAA
AAAAAGAATTATAATGATTTAGATTATTAAGAAGTAATAACTGTAGAACCAAAAAAACAA
AGGATAAATGATGATGATGAATTTTATTGGGAAGAGGTTGATTCATTTTTGGATGATGAT
GGCCTCGATGAAGTATGCTACATTTGTGAGACCAATTAAGATGAAAATAAACTAATAATT
TGTGACCACTGTGGGTTTAGAATATGTCACACGTATTGTGATGATGAGTTGCTTGATGAC
TAAGTACCTTTAGAAGATTGGTTTTGTCATGAGTGCAGACAAAGATCAGAATTATTTGAT
TGA


>TTHERM_00106910(protein)
MRQLRNQRSQQDQGFSFQSNPLPSNNKFDKNQEESKCEQYCMSQRDIEGFNTDLNIFTAK
YKVYENVDFSSPSFYKKKHILSDVQEKENEFLNQISDQKSQHSYGNNLDEYNIVKSSYSL
NSHNSQKQQNQVYESERKPIFGPFTITQKEIFSNHNSKSKNQEQKSLYESIEYTRRNPFS
FEKNQIQDNQISEIKNVPKKREMSVEQEYGQVVNKTKYNQTNKQQLNNNDFDFSDHKDKS
HKNVFDDNQEYFGFKNMNQENKIYETPNNFEQKRKGKYRARIIDSSSAKQQNFNQNSNQS
CTFKNLNKQIDLNNIIQNPSSKRRLTRSTNILHESFQKQIFQRQESLNQNKRMRNSNNKN
EMKDERNQTCINKTKQEESKKLKKLVKNKRKSEGKNESLTQKQNLMSQQLKNCAICLGIP
EDSIYGVVQCQHEFCIDCILQWSEVTNLCPMCRAEFSKIQKKNYNDLDYQEVITVEPKKQ
RINDDDEFYWEEVDSFLDDDGLDEVCYICETNQDENKLIICDHCGFRICHTYCDDELLDD
QVPLEDWFCHECRQRSELFD


>TTHERM_00106910(gene)
ATGCGTTAGTTAAGAAACTAAAGATCATAGCAAGATTAAGGATTTTCATTTTAGTCTAAT
CCACTTCCCAGTAATAATAAGTTTGATAAAAATTAAGAAGAAAGCAAATGTGAATAATAT
TGCATGAGCTAAAGAGATATTGAAGGGTTTAATACTGATTTGAATATTTTCACTGCAAAA
TATAAAGTATATGAGAATGTAGATTTTTCTTCTCCATCTTTTTACAAAAAAAAACATATT
TTGAGTGATGTGTAAGAAAAAGAAAATGAATTTTTAAATCAAATAAGTGACCAAAAAAGT
CAGCATTCATATGGAAATAATTTAGATGAGTATAATATAGTTAAATCAAGCTACAGCTTG
AACTCTCACAACTCTTAAAAACAGCAAAATCAAGTATATGAGAGTGAAAGAAAGCCTATT
TTTGGACCTTTTACAATTACTTAAAAAGAAATTTTTAGTAATCATAATAGCAAAAGTAAA
AACTAAGAATAAAAGAGTCTTTATGAATCAATAGAATATACAAGAAGGAATCCTTTTAGT
TTTGAAAAAAATTAAATATAAGATAATTAAATAAGTGAAATTAAAAATGTGCCAAAAAAG
AGAGAAATGAGTGTAGAACAAGAGTATGGCTAGGTTGTAAATAAGACTAAATATAATTAA
ACAAATAAATAACAACTAAATAATAATGATTTTGATTTTAGTGATCATAAAGACAAATCA
CATAAAAATGTTTTTGATGATAATTAAGAATATTTTGGTTTTAAAAATATGAATTAAGAA
AACAAAATTTATGAAACACCAAACAACTTTGAATAAAAAAGAAAAGGAAAATATAGAGCT
CGAATAATAGATTCATCAAGTGCAAAGTAGTAGAACTTTAATCAGAATAGTAATTAATCA
TGTACCTTCAAAAATTTAAATAAATAAATAGATCTAAATAATATAATTTAAAATCCTTCA
TCGAAGAGAAGACTAACAAGGTCTACTAATATTCTTCATGAATCCTTTCAAAAACAAATT
TTCTAGAGGTAGGAATCATTAAATTAAAATAAAAGAATGAGAAATTCTAATAATAAGAAT
GAAATGAAAGATGAAAGGAATTAGACTTGCATAAATAAAACAAAGTAAGAAGAGTCTAAG
AAGTTAAAAAAATTGGTAAAAAATAAAAGAAAATCAGAAGGAAAGAACGAATCGTTAACT
TAAAAGTAAAATCTAATGTCATAGCAACTCAAAAATTGTGCAATTTGTTTGGGAATACCA
GAAGATAGTATATATGGAGTTGTTTAATGTTAGCATGAATTTTGCATTGATTGCATTCTA
CAGTGGTCTGAAGTAACTAATTTGTGTCCTATGTGCAGAGCAGAATTCAGCAAAATATAA
AAAAAGAATTATAATGATTTAGATTATTAAGAAGTAATAACTGTAGAACCAAAAAAACAA
AGGATAAATGATGATGATGAATTTTATTGGGAAGAGGTATTTTATATTAATTCTAATTTA
TTCGTAGTTAAATCATCAAAAAGATGAATTATAAAAAACCTATTTAATATTAAAATTAGT
AAAGTTAGTATAAATTTAGACTGAATTAATTCAAGCATATATTACAATTTATTTAATTAA
AAAAATTCAATAAATTTAGGTTGATTCATTTTTGGATGATGATGGCCTCGATGAAGTATG
CTACATTTGTGAGACCAATTAAGATGAAAATAAACTAATAATTTGTGACCACTGTGGGTT
TAGAATATGTCACACGTATTGTGATGATGAGTTGCTTGATGACTAAGTACCTTTAGAAGA
TTGGTTTTGTCATGAGTGCAGACAAAGATCAGAATTATTTGATTGA