Identifiers and Description

Gene Model Identifier

TTHERM_00105230

Standard Name

None

Aliases

PreTt23023 | 7.m00472

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06636 ) Protein of unknown function (DUF1157)
  • ( PF03540 ) Transcription initiation factor TFIID 23-30kDa

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.7%

TetraMine Data

TTHERM_00105230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00362.11.000274544751666e-156hypothetical protein (298 aa)
DictyBaseDDB_G02821690.00000019998969434520019DDB_G0282169 on chromosome: 3
position 5479724 to 5481160

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00105230(coding)
ATGGATTAAGCTTTTAAGTAGAACTTATGGAAGTTAATATATTTAGAGATTAATATGGTT
ACTCCAATAATCATTATGTGCATCAGTTTGATTTACTTTGATATGTACACTTTGACCATC
TTTCTCTACAATTCGATTTGTTTAGTTATAATGCCTGCAATTTACATTAAATTTATTTTG
AAAGATCCAAAGAAAAAAGAGCTTTCATACTACTTTAGAAACAGATTGGAAAACCCAAAA
AAGTAGATGATAGTTGGCTTTATTCTTTTTTCTGTCATATATGCTGCAATTGTTATTAAT
TATGATATCTGTGAGAATTATTTTAAAAAGGAGATAATTGATGAAATACATGTTAATTTT
GATAAAAAAATTTTAAACTTTGTTGTATTGGTCATCATTTTTGGATTTTGCAATCCTTTT
TTAGAAGAATGGTACTGGAGAAACTTTATCCCTCAAGCTATTTTTGATCTCTTAAATCAT
AGCTATAATAACGAAAATGAAAATTAGGATGACAGATTGGAGTAAGGCAGCGGAGAATTC
CATAACTTTTAAGATAATGACTTAGAAAATAGAATTAATGATTAGTATAACTCTTAACTC
GAATATAATGTAGAAAGTAATAGACCAACAAATAAACTTTCAAATAAGAATGTAGAAATC
TTTCAACTTCTTTATGCCTTGCACTATTCAAGTTATCACTTCTTTGTTGTCATGCACATC
ACTAATCCCTACTTTGCCATAGCAGGTACTCTTGTAGTATGGATAGCAGGTAGAGTATTC
TTATTGATTAACAATAAAGTAGGTTTCATAGCAAATGGACTTGCTCATATGGGAGCTGAC
GTTGGGTTTTGCACTCTTGCTCTAGTAATTTTCTATAATAATAAAATATTATGA


>TTHERM_00105230(protein)
MDQAFKQNLWKLIYLEINMVTPIIIMCISLIYFDMYTLTIFLYNSICLVIMPAIYIKFIL
KDPKKKELSYYFRNRLENPKKQMIVGFILFSVIYAAIVINYDICENYFKKEIIDEIHVNF
DKKILNFVVLVIIFGFCNPFLEEWYWRNFIPQAIFDLLNHSYNNENENQDDRLEQGSGEF
HNFQDNDLENRINDQYNSQLEYNVESNRPTNKLSNKNVEIFQLLYALHYSSYHFFVVMHI
TNPYFAIAGTLVVWIAGRVFLLINNKVGFIANGLAHMGADVGFCTLALVIFYNNKIL


>TTHERM_00105230(gene)
AATTATATTGCTAATTATATTAAACAAGGATAATTTAATTTTCTCACAAAAAGATGGATT
AAGCTTTTAAGTAGAACTTATGGAAGTTAATATATTTAGAGATTAATATGGTTACTCCAA
TAATCATTATGTGCATCAGTTTGATTTACTTTGATATGTACACTTTGACCATCTTTCTCT
ACAATTCGATTTGTTTAGTTATAATGCCTGCAATTTACATTAAATTTATTTTGAAAGATC
CAAAGAAAAAAGAGCTTTCATACTACTTTAGAAACAGATTGGAAAACCCAAAAAAGTAGA
TGATAGTTGGCTTTATTCTTTTTTCTGTCATATATGCTGCAATTGTTATTAATTATGATA
TCTGTGAGAATTATTTTAAAAAGGAGATAATTGATGAAATACATGTTAATTTTGATAAAA
AAATTTTAAACTTTGTTGTATTGGTCATCATTTTTGGATTTTGCAATCCTTTTTTAGAAG
AATGGTACTGGAGAAACTTTATCCCTCAAGCTATTTTTGATCTCTTAAATCATAGCTATA
ATAACGAAAATGAAAATTAGGATGACAGATTGGAGTAAGGCAGCGGAGAATTCCATAACT
TTTAAGATAATGACTTAGAAAATAGAATTAATGATTAGTATAACTCTTAACTCGAATATA
ATGTAGAAAGTAATAGACCAACAAATAAACTTTCAAATAAGAATGTAGAAATCTTTCAAC
TTCTTTATGCCTTGCACTATTCAAGTTATCACTTCTTTGTTGTCATGCACATCACTAATC
CCTACTTTGCCATAGCAGGTACTCTTGTAGTATGGATAGCAGGTAGAGTATTCTTATTGA
TTAACAATAAAGTAGGTTTCATAGCAAATGGACTTGCTCATATGGGAGCTGACGTTGGGT
TTTGCACTCTTGCTCTAGTAATTTTCTATAATAATAAAATATTATGAAATGTTTTTGAAA
AAATAAAAATATAAAAGACTCTTTTTAAAACAACAATAAAAAATATTATCAAAACTTAAT
TAATTAATATCTCATTTATTGATCATTTAAACTCTACCATTTTTTGTTATTCTTTGTAAT
TTTTATTCAATTACCTCTTAAAATAATAAAATCCACTCAAGTCAATT