Identifiers and Description

Gene Model Identifier

TTHERM_00088120

Standard Name

None

Aliases

PreTt16462 | 6.m00536 | 3836.m02128

Description

p1/s1 nuclease

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 79.9%

TetraMine Data

TTHERM_00088120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02499.19.997093137033517e-262S1/P1 Nuclease (325 aa)
OxytrichaContig18628.0.g891.9994920269952867e-34S1/P1 Nuclease
Stentor CoeruleusSteCoe_178402.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00088120(coding)
ATGAGAAATACCTTTTTGCTTTGCATTTTATTGATCGCAGGAGTTAGCTGCTGGTGGGAT
GGTGGTCATATGATGACTGCTGAAATCGCTAAGTAAGAAATTCTTGCAAGAAATGCTACT
CTTTACGAACAAATTGAAAAGTACGTCACTATTCTTAACCCTCTCTGTGATGCAAGAAGT
TAAGATTTTGTCTAAGCTGCTAGTTGGGCTGATGATATCAAGGATGATGCTATGAATTTC
TGGTACGGATGGCACTTCTATGACAAGCCTGAAAATCCTTAAGGTTTGTATGTTATTTTG
GATTAGGACAACCAAGTCTACAACAGTATTACTGGCATCAAGAGAGCTATTTAAGAGTTA
TCTAGAAAGTATTATTTACCTCTTTAAAACAACTTGAATATATCAGTATAATAAGCTATT
ATGATGCGTCTTTTAATACATATTGTCGGTGATATGCATCAACCTCTTCATAATGTTAAT
ATGTACAACTACACTTACACTTAAGGTGATTTAGGTGGTAACAAGGAAAAAATTTTACTC
CTCAACAAGACTTCTATGATTCTCCACTCCTATTTTGATAGTGGCGCAACTCGTCTTGAC
AGCTTCCCTCGTCCTCTTACATAAGAAAAATTAAGTAATCTTTCTGCTTTAGCTTATGAA
TTCAGAGCCTAATATCCCAGATCTTATTTCGGTCAAAGAATGAATGTCACCACTCCTGAA
CAATGGGCTTAAGAATCCTATGATATTGCTCACAATTTCATTTATCCTTTTGTTACTAAA
ACTAATCAAATTACTCCTGAATGGGATACTGAATCCTACGAAATAATCAAGTAATAACTT
GCTTTGGGTGGTTATAGACTTGCTGATATCTTACTTGGTATCTTTTAAAACTAAACTGCA
CCAGTTAACCAAACTAAATCTACAAATACCTAAACTAATTCTACTTCTAATCTTAGAAAG
ACAATTATTGCTTGA


>TTHERM_00088120(protein)
MRNTFLLCILLIAGVSCWWDGGHMMTAEIAKQEILARNATLYEQIEKYVTILNPLCDARS
QDFVQAASWADDIKDDAMNFWYGWHFYDKPENPQGLYVILDQDNQVYNSITGIKRAIQEL
SRKYYLPLQNNLNISVQQAIMMRLLIHIVGDMHQPLHNVNMYNYTYTQGDLGGNKEKILL
LNKTSMILHSYFDSGATRLDSFPRPLTQEKLSNLSALAYEFRAQYPRSYFGQRMNVTTPE
QWAQESYDIAHNFIYPFVTKTNQITPEWDTESYEIIKQQLALGGYRLADILLGIFQNQTA
PVNQTKSTNTQTNSTSNLRKTIIA


>TTHERM_00088120(gene)
ATGAGAAATACCTTTTTGCTTTGCATTTTATTGATCGCAGGAGTTAGCTGCTGGTGGGAT
GGTGGTCATATGATGACTGCTGAAATCGCTAAGTAAGAAATTCTTGCAAGAAATGCTACT
CTTTACGAACAAATTGAAAAGTACGTCACTATTCTTAACCCTCTCTGTGATGCAAGAAGT
TAAGATTTTGTCTAAGCTGCTAGTTGGGCTGATGATATCAAGGATGATGCTATGAATTTC
TGGTACGGATGGCACTTCTATGACAAGCCTGAAAATCCTTAAGGTTTGTATGTTATTTTG
GATTAGGACAACCAAGTCTACAACAGTATTACTGGCATCAAGAGAGCTATTTAAGAGTTA
TCTAGAAAGTATTATTTACCTCTTTAAAACAACTTGAATATATCAGTATAATAAGCTATT
ATGATGCGTCTTTTAATACATATTGTCGGTGATATGCATCAACCTCTTCATAATGTTAAT
ATGTACAACTACACTTACACTTAAGGTGATTTAGGTGGTAACAAGGAAAAAATTTTACTC
CTCAACAAGACTTCTATGATTCTCCACTCCTATTTTGATAGTGGCGCAACTCGTCTTGAC
AGCTTCCCTCGTCCTCTTACATAAGAAAAATTAAGTAATCTTTCTGCTTTAGCTTATGAA
TTCAGAGCCTAATATCCCAGATCTTATTTCGGTCAAAGAATGAATGTCACCACTCCTGAA
CAATGGGCTTAAGAATCCTATGATATTGCTCACAATTTCATTTATCCTTTTGTTACTAAA
ACTAATCAAATTACTCCTGAATGGGATACTGAATCCTACGAAATAATCAAGTAATAACTT
GCTTTGGGTGGTTATAGACTTGCTGATATCTTACTTGGTATCTTTTAAAACTAAACTGCA
CCAGTTAACCAAACTAAATCTACAAATACCTAAACTAATTCTACTTCTAATCTTAGAAAG
ACAATTATTGCTTGA