Identifiers and Description

Gene Model Identifier

TTHERM_00086720

Standard Name

COI6 (COnjugation-Induced 6)

Aliases

PreTt16421 | 6.m00495 | 3836.m02088 | HPL1

Description

Heterochromatin Protein 1 (HP1) like protein; specifically expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00385 ) 'chromo' (CHRromatin Organization MOdifier) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00086720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02463.14.000904604388404e-59hypothetical protein (1621 aa)
OxytrichaContig19010.0.g640.000030009396760408108Chromo (CHRromatin Organisatio
n MOdifier) domain

General Information

Paragraph NoGene NameParagraph Text
111JUB1,
JUB2,
JUB3,
JUB4,
HPL2,
COI3,
COI6,
COI16,
JUB6
This protein co-localizes with Pdd1p in heterochromatin body in the new macronucleus.
115COI6,
JMJ1,
LIA5,
COI7
Coi6p, its interaction partners Coi7p and Lia5p, and the histone demethylase Jmj1p are crucial for confining the production of small RNAs and the formation of heterochromatin to the eliminated sequences. The loss of Coi6p, Coi7p or Jmj1p causes ectopic DNA elimination.
114COI7,
COI6
Coi7p directly interacts with Coi6p and is required for the stable accumulation of Coi6p.

Associated Literature

  1. Ref:29021213: Noto T, Mochizuki K (2017) Whats, hows and whys of programmed DNA elimination in Tetrahymena. Open biology 7(10):
  2. Ref:28692189: Wiley EA, Horrell S, Yoshino A, C Schornak C, Bagnani C, L Chalker D (2017) Diversification of HP1-like Chromo Domain Proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology ( ):
  3. Ref:28273462: Suhren JH, Noto T, Kataoka K, Gao S, Liu Y, Mochizuki K (2017) Negative Regulators of an RNAi-Heterochromatin Positive Feedback Loop Safeguard Somatic Genome Integrity in Tetrahymena. Cell reports 18(10):2494-2507
  4. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77
  5. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00086720(coding)
ATGGCTAAGATAAAATACGAAGGAAGTCAAAAATAGAATGTAAAGAAAAGAACTATGCAT
GTGGTTGATGATGATGAAGACGAAGAGCAACCGGTTTATCCCATAGAAGAAGAATACAAT
GTTGAATATTTATATGGAAAAAAATTTGAAAATGGTTAAATTAAGTATTGTGTAAAATGG
GAAAATTATACTTTTGAAGAAAGTTCATTCGAGCCAGTAGAAAATCTAGAAAATGTTGTC
TACAATATGAGGGGATTTGAAAGAAAAATGAGTGATTTGATATTTAGAGTTGCTTTGCTC
TAAAATGCTAAGAAAAAATTACCTCCATTTTAAGTTAATCCTATTCAATTAATTCAAAAA
GATAACATTGAAAATACTAAGGAATAAATAGAGCCTTCTTAGGCATAAAACCACCTATAA
AAAGAGCCTTCTGTAATTAACAATTAAACTAGTGTAGAGAAATTTCAAAGTGCACCATAA
TAATCACCTAAAAAAATCAATGGTGGAATATCAGATAACCAAATTACGTAGAATTAGTAA
AGCTTAATTGAAACTAATTTAAATTCAAACAATAACTGTTAGATTTAAGGAAGTCCTAAA
TTAGCTGAAAATCTAGAAAAACCTCAAAATGGTAGCTAAAATTTAGCTGAAAAAAATTAC
CTGAAGACAAATGGAAACAGTAATAATTAATTATAGCACAATCACAACAACCAATAACAA
AATAATGGAAATTAATTATTGAATCTTAATTAGAGTTTAAATTTATTGTAAAGTAACGGA
TAGCATTAAAGCTAGTAAAAATAATCATCTAATGGAAATAATTAAAACTCTCAAAACAAA
TAAAGCCTTTCTTATAACTTAAATGGTAATGGATAACATTAAAAGAAGGTTGAAAATTAA
GCAATTGGTTAAGTTAATTCAATTAGTTAAGTTTAAAATAAATAAACTTAACTTTATGAA
AAAAATCGTAGAACAAATTCTTAAGATTAGTATATTTAAACTAAATTAGATCAAAACCTT
AGTTATATATCTTAAAAGCAATTACCAAAGCCTATTGAAGACAATAAAACAATGGAGGTT
GTACAAACAAAAAACAAAAGTCAACTTCAATTTAGAGATCCAGTTCTGGAAAACGAATTA
AACAGCAATGCTTATTCAGCATAAGTAGTTGTAGATGATACTAGCAAATATGGTAATTTC
AACAACGGAGACATTCCTCTTAAAATATTGAAGCATGCTCCTTATACAAGAATTCAGAAA
GTGATAGGAAATAATGTCGATTTACCTAGCAGTCTTTACTTTAAAGTTATATTTAAACCT
AGACCTTCTGGTACAGTTCCTTAACCTGCCTATATTGCATTCAATGAGCTCAAAGATAGA
TACCCAAGAGTTTTAATGGAATACTATGAGTAACATGCAATTTTGTTAGATCCTGTTCCA
GATTAGGCAGAACTCTAGTTGTAAAAGACAAACAGTAGGGATTTAAATGTCAAGAATGAT
GCATCTCTTATTTCAAACGCAGGAAATAATAAGAAGATGGTAAACGGGAAAGAAAATAGA
ATAAATATCTGA


>TTHERM_00086720(protein)
MAKIKYEGSQKQNVKKRTMHVVDDDEDEEQPVYPIEEEYNVEYLYGKKFENGQIKYCVKW
ENYTFEESSFEPVENLENVVYNMRGFERKMSDLIFRVALLQNAKKKLPPFQVNPIQLIQK
DNIENTKEQIEPSQAQNHLQKEPSVINNQTSVEKFQSAPQQSPKKINGGISDNQITQNQQ
SLIETNLNSNNNCQIQGSPKLAENLEKPQNGSQNLAEKNYLKTNGNSNNQLQHNHNNQQQ
NNGNQLLNLNQSLNLLQSNGQHQSQQKQSSNGNNQNSQNKQSLSYNLNGNGQHQKKVENQ
AIGQVNSISQVQNKQTQLYEKNRRTNSQDQYIQTKLDQNLSYISQKQLPKPIEDNKTMEV
VQTKNKSQLQFRDPVLENELNSNAYSAQVVVDDTSKYGNFNNGDIPLKILKHAPYTRIQK
VIGNNVDLPSSLYFKVIFKPRPSGTVPQPAYIAFNELKDRYPRVLMEYYEQHAILLDPVP
DQAELQLQKTNSRDLNVKNDASLISNAGNNKKMVNGKENRINI


>TTHERM_00086720(gene)
ATGGCTAAGATAAAATACGAAGGAAGTCAAAAATAGAATGTAAAGAAAAGAACTATGCAT
GTGGTTGATGATGATGAAGACGAAGAGCAACCGGTTTATCGTAAATTATAGATTTTTGAT
TATTTTTAAATAAATTTTTTTATTTTAATATAGCCATAGAAGAAGAATACAATGTTGAAT
ATTTATATGGAAAAAAATTTGAAAATGGTTAAATTAAGTATTGTGTAAAATGGGAAAATT
ATACTTTTGAAGAAAGTTCATTCGAGCCAGTAGAAAATCTAGAAAATGTTGTCTACAATA
TGAGGGGATTTGAAAGAAAAATGAGTGATTTGATATTTAGAGTTGCTTTGCTCTAAAATG
CTAAGAAAAAATTACCTCCATTTTAAGTTAATCCTATTCAATTAATTCAAAAAGATAACA
TTGAAAATACTAAGGAATAAATAGAGCCTTCTTAGGCATAAAACCACCTATAAAAAGAGC
CTTCTGTAATTAACAATTAAACTAGTGTAGAGAAATTTCAAAGTGCACCATAATAATCAC
CTAAAAAAATCAATGGTGGAATATCAGATAACCAAATTACGTAGAATTAGTAAAGCTTAA
TTGAAACTAATTTAAATTCAAACAATAACTGTTAGATTTAAGGAAGTCCTAAATTAGCTG
AAAATCTAGAAAAACCTCAAAATGGTAGCTAAAATTTAGCTGAAAAAAATTACCTGAAGA
CAAATGGAAACAGTAATAATTAATTATAGCACAATCACAACAACCAATAACAAAATAATG
GAAATTAATTATTGAATCTTAATTAGAGTTTAAATTTATTGTAAAGTAACGGATAGCATT
AAAGCTAGTAAAAATAATCATCTAATGGAAATAATTAAAACTCTCAAAACAAATAAAGCC
TTTCTTATAACTTAAATGGTAATGGATAACATTAAAAGAAGGTTGAAAATTAAGCAATTG
GTTAAGTTAATTCAATTAGTTAAGTTTAAAATAAATAAACTTAACTTTATGAAAAAAATC
GTAGAACAAATTCTTAAGATTAGTATATTTAAACTAAATTAGATCAAAACCTTAGTTATA
TATCTTAAAAGCAATTACCAAAGCCTATTGAAGACAATAAAACAATGGAGGTTGTACAAA
CAAAAAACAAAAGTCAACTTCAATTTAGAGATCCAGTTCTGGAAAACGAATTAAACAGCA
ATGCTTATTCAGCATAAGTAGTTGTAGATGATACTAGCAAATATGGTAATTTCAACAACG
GAGACATTCCTCTTAAAATATTGAAGCATGCTCCTTATACAAGAATTCAGAAAGTGATAG
GAAATAATGTCGATTTACCTAGCAGTCTTTACTTTAAAGTTATATTTAAACCTAGACCTT
CTGGTACAGTTCCTTAACCTGCCTATATTGCATTCAATGAGCTCAAAGATAGATACCCAA
GAGTTTTAATGGAATACTATGAGTAACATGCAATTTTGTTAGATCCTGTTCCAGATTAGG
CAGAACTCTAGTTGTAAAAGACAAACAGTAGGGATTTAAATGTCAAGAATGATGCATCTC
TTATTTCAAACGCAGGAAATAATAAGAAGATGGTAAACGGGAAAGAAAATAGAATAAATA
TCTGA