Identifiers and Description

Gene Model Identifier

TTHERM_00083680

Standard Name

None

Aliases

PreTt16315 | 6.m00389 | 3836.m01985

Description

nucleolar protein-Nop52 protein; Nucleolar protein-Nop52 containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00083680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02395.19.997093137033517e-262F-box domain-containing protei
n (1466 aa)
WormBaseWBGene000081510.00000000000004998767099442072Ribosomal RNA processing prote
in 1 homolog status:Confirme
d UniProt:Q18674 protein_i
d:CAA93111.1
SGDYDR087C0.000000000007000776811212012RRP1 Essential evolutionarily
conserved nucleolar protein ne
cessary for biogenesis of 60S
ribosomal subunits and process
ing of pre-rRNAs to mature rRN
As, associated with several di
stinct 66S pre-ribosomal parti
cles
OxytrichaContig22160.0.g700.00000000002000577768187062Nucleolar protein,Nop52
DictyBaseDDB_G02793210.000000000029994712494008525DDB_G0279321 on chromosome: 3
position 1932547 to 1934192

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00083680(coding)
ATGAGTATATCCACAGAAAACAATTCCAATAACAATAGCGCTTCTAACACTAATGCAATC
ACTCCTGCAATTATTGCTAAAAAGCTATCAGCTATTGTTCCTGCTAACACAAAAGAAGTG
ATTGAAGAAGTTAAATCATATTTAGATTCATAAAAGCTTGATAAAGATGGATATCGTTAA
ATCTGGAAAGGAATCTTCTTTGCTATGTGGGCAAGTGATAAAGTTCCTGTTTAATAAGCT
CTAGCTGATGAATTGGCTAATCTTATTTTTAGTGTCAATAAACAAAAATTTGAAGCCATT
AACATGTGGTTTTAAGCTTGTTTCAATATAATGAATAAGGAATGGGCTAAAATTGATTAC
TGGAGAGTAAATAAGTTCTCCTCCTTAATGAGAAAAGTTATAACTGCCTTTATCAGATAT
TTAAGGAAGAAAGGCTATAATACTGATTATGTCAGATAATTCAGCAAATCTGTTCATGAT
GAATTCTACGTTGAACAAACTCAAACAGTAAGTGGATTAGCTCTACATATTATGCAAATA
TTCCCAGAAGTTTTGAGTCATTTTACTAGTGCAAAACATGATTAAGTTTGTTTGTTTCTT
GATATCTTCTTGAAATAGCTCAATCCTAATTCTTGCAAGGGACTTAGATAAAAAATAAAG
GAATGCATTTTCGAAAAAATAATAGAATTGAAGAATTCATCTTAGCTATATTAAAATTTT
AACTTGAAAGCTTATCGTGAAAAGTTATTTGACATAGCAAAAAAGAAGAAAACTGATGAT
GTCTCAAGAAAGGAAATTTATGAAATAGTCGAGCTTATAGATGCTAATGTTTAATTAGAT
GAAGAAGATGAAAGATATAACAAGTACATTAAAGAAAAGGAAGAAAATAGATAAAAGGTT
AATGCAGAAAAAGAACTTAAAAAGAAAGCCAAAGAACCTTCATAAAAGAAAAATAAAGAT
GAAAAACAATCAAATAAAAAAGAAGAAAAAGTTAACAAGAAGGCTGATTTAGAAAATGAA
GAGTAAAACAAATAAAAAAAGTAAAAACTCAATGATACATCTGCAAAATCAGTTGATAAT
AAATAGTAAAAGGTGACTGAGTCAAATAAAAAAAATGAAGAATAAAAAGAAAACAAAAGT
TCAGCAAATACTAAAAATGAAGAAAAGTTAACTAAATAGCAAAAGAAAGAGCTTAAAAAG
TAAGAAAAATTATAGCAAATGATAGATGAGGAAGAAAAGAAACTTTTATAAGAAGAAAAA
AAACTCAATTAAATGGAACAAAAGCTATTAAAATAGGAAAAAAATGGTGAAAAGCTTTCT
AAAAATGCTAAGAAACAAGTATAGGAACCTGAATAAAATGAAGAAGATTGGGATGATGAA
GAAGACGATGAAGAAGAAGATTTTTAAGATGAAGAAGGAGAGGAAGATGATGAAGACGAA
GACGATGAAGATTTCTAAGGAGAAGAAGATGAAGAAGATGACGAAGAAGAGGATGAAGAA
GAAGATTGCGATGAAGAAGAAATGGAACTTACTGAGGAATAATTAAAAGCTATATTAGGC
AAAAACGGTGATTTGGAAGATGATGAAGATGAATTAGATGAAGAAGAATTGCAGATGTTA
ATTAAAGGTACTGCTGAAGACATTGAGGTCGATGATATGGATGATGATTTTTACTGTGAA
GATGATTTTGAGGGATATGACATTTAGGAAGTTACTAATAATCCTCTCAGAATTAATGGA
TTATAAAATGTCTATAACAGCTTACCTGAATATCATTTTCTTTCAGATCCTTAAAAAATT
AAATACTTTAATAACTTAACAAGCAAATTTAAATAAAATCTTTTAAAAGAAAAAACAAAT
GGCTGCTCTCATAAAAAATCTGTAATTATCAATACAAACAACAACTTGATCAAAGAGTTT
GATTTGAATGAAGAAGTCACAGCAATCTCTAAAGCCCCTGTCATAAAGAAAGCCAAAAAG
GTTAAAACAGCAGCTTGA


>TTHERM_00083680(protein)
MSISTENNSNNNSASNTNAITPAIIAKKLSAIVPANTKEVIEEVKSYLDSQKLDKDGYRQ
IWKGIFFAMWASDKVPVQQALADELANLIFSVNKQKFEAINMWFQACFNIMNKEWAKIDY
WRVNKFSSLMRKVITAFIRYLRKKGYNTDYVRQFSKSVHDEFYVEQTQTVSGLALHIMQI
FPEVLSHFTSAKHDQVCLFLDIFLKQLNPNSCKGLRQKIKECIFEKIIELKNSSQLYQNF
NLKAYREKLFDIAKKKKTDDVSRKEIYEIVELIDANVQLDEEDERYNKYIKEKEENRQKV
NAEKELKKKAKEPSQKKNKDEKQSNKKEEKVNKKADLENEEQNKQKKQKLNDTSAKSVDN
KQQKVTESNKKNEEQKENKSSANTKNEEKLTKQQKKELKKQEKLQQMIDEEEKKLLQEEK
KLNQMEQKLLKQEKNGEKLSKNAKKQVQEPEQNEEDWDDEEDDEEEDFQDEEGEEDDEDE
DDEDFQGEEDEEDDEEEDEEEDCDEEEMELTEEQLKAILGKNGDLEDDEDELDEEELQML
IKGTAEDIEVDDMDDDFYCEDDFEGYDIQEVTNNPLRINGLQNVYNSLPEYHFLSDPQKI
KYFNNLTSKFKQNLLKEKTNGCSHKKSVIINTNNNLIKEFDLNEEVTAISKAPVIKKAKK
VKTAA


>TTHERM_00083680(gene)
ATGAGTATATCCACAGAAAACAATTCCAATAACAATAGCGCTTCTAACACTAATGCAATC
ACTCCTGCAATTATTGCTAAAAAGCTATCAGCTATTGGTACGAAAATAGATAAATAAATG
AATTTGGAAAACACTAAACTCTTTTTTTTTAAACAAAATAGTTCCTGCTAACACAAAAGA
AGTGATTGAAGAAGTTAAATCATATTTAGATTCATAAAAGCTTGATAAAGATGGATATCG
TTAAATCTGGAAAGGAATCTTCTTTGGTATGTTTATATCTTAAAAATAGTTTACATTAGA
AATTTAAGTAAAAATTCTTTACTTTATAATAAAATAGCTATGTGGGCAAGTGATAAAGTT
CCTGTTTAATAAGCTCTAGCTGATGAATTGGCTAATCTTATTTTTAGTGTCAATAAACAA
AAATTTGAAGCCATTAACATGTGGTTTTAAGCTTGTTTCAATATAATGAATAAGGAATGG
GCTAAAATTGATTACTGGAGAGTAAATAAGTTCTCCTCCTTAATGAGAAAAGTTATAACT
GCCTTTATCAGATATTTAAGGAAGAAAGGCTATAATACTGATGTAATTATTGATTAATTA
CTAATTCTACTCAATTTAATTCTCAAATAAAAAGCACATAGATTTTAATCCTTATTTAAA
AAATAATAATTAGTATGTCAGATAATTCAGCAAATCTGTTCATGATGAATTCTACGTTGA
ACAAACTCAAACAGGTAAGAATTTTCATATTTTGATCATTTTGACTTAAAAATTTATCTA
TTAATAAATCTGTCTATCTTTTTAAAGTAAATTTACTCCTTAGATTATTCTCCTAAATAG
CTTAAAAATGTATTAAAATAAACTATTTCTCATAAAAAGCCAAATTAAAAAGCAAATTAG
TAGAAGGCTTACTATTTAGGAATTAAATTTATTTAAAGTATCAAACAGTTTATTCACAAA
GTGCTTGTGAGTTAAATTAATTGATTGTTTATTAGTTACATTGATAGATAGATATAAAAA
TAAATAGATAAATTTTTGATTAATTTGTCAATATTTAAAATTCTAATTAATTTTTAATCA
GTAAGTGGATTAGCTCTACATATTATGCAAATATTCCCAGAAGTTTTGAGTCATTTTACT
AGTGCAAAACATGATTAAGTTTGTTTGTTTCTTGATATCTTCTTGAAATAGCTCAATCCT
AATTCTTGCAAGGGACTTAGATAAAAAATAAAGGAATGCATTTTCGAAAAAATAATAGAA
TTGAAGAATTCATCTTAGCTATATTAAAATTTTAACTTGAAAGCTTATCGTGAAAAGTTA
TTTGACATAGCAAAAAAGAAGTAATAGATAATTAGACTAACTTAAATATAAATATTAAAT
GCTTCTTATATATAATTAGGAAAACTGATGATGTCTCAAGAAAGGAAATTTATGAAATAG
TCGAGCTTATAGATGCTAATGTTTAATTAGATGAAGAAGATGAAAGATATAACAAGTACA
TTAAAGAAAAGGAAGAAAATAGATAAAAGGTTAATGCAGAAAAAGAACTTAAAAAGAAAG
CCAAAGAACCTTCATAAAAGAAAAATAAAGATGAAAAACAATCAAATAAAAAAGAAGAAA
AAGTTAACAAGAAGGCTGATTTAGAAAATGAAGAGTAAAACAAATAAAAAAAGTAAAAAC
TCAATGATACATCTGCAAAATCAGTTGATAATAAATAGTAAAAGGTGACTGAGTCAAATA
AAAAAAATGAAGAATAAAAAGAAAACAAAAGTTCAGCAAATACTAAAAATGAAGAAAAGT
TAACTAAATAGCAAAAGAAAGAGCTTAAAAAGTAAGAAAAATTATAGCAAATGATAGATG
AGGAAGAAAAGAAACTTTTATAAGAAGAAAAAAAACTCAATTAAATGGAACAAAAGCTAT
TAAAATAGGAAAAAAATGGTGAAAAGCTTTCTAAAAATGCTAAGAAACAAGTATAGGAAC
CTGAATAAAATGAAGAAGATTGGGATGATGAAGAAGACGATGAAGAAGAAGATTTTTAAG
ATGAAGAAGGAGAGGAAGATGATGAAGACGAAGACGATGAAGATTTCTAAGGAGAAGAAG
ATGAAGAAGATGACGAAGAAGAGGATGAAGAAGAAGATTGCGATGAAGAAGAAATGGAAC
TTACTGAGGAATAATTAAAAGCTATATTAGGCAAAAACGGTGATTTGGAAGATGATGAAG
ATGAATTAGATGAAGAAGAATTGCAGATGTTAATTAAAGGTACTGCTGAAGACATTGAGG
TCGATGATATGGATGATGATTTTTACTGTGAAGATGATTTTGAGGGATATGACATTTAGG
AAGTTACTAATAATCCTCTCAGAATTAATGGATTATAAAATGTCTATAACAGCTTACCTG
AATATCATTTTCTTTCAGATCCTTAAAAAATTAAATACTTTAATAACTTAACAAGCAAAT
TTAAATAAAATCTTTTAAAAGAAAAAACAAATGGCTGCTCTCATAAAAAATCTGTAATTA
TCAATACAAACAACAACTTGATCAAAGGTAAATTTTTTTTTTGATATTACGATCTTATAT
TTAAATAATATTTTTAAAGAGTTTGATTTGAATGAAGAAGTCACAGCAATCTCTAAAGCC
CCTGTCATAAAGAAAGCCAAAAAGGTTAAAACAGCAGCTTGA