Identifiers and Description

Gene Model Identifier

TTHERM_00082260

Standard Name

None

Aliases

PreTt16272 | 6.m00346 | 3836.m01945

Description

Dpy-30 motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00082260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02369.14.99918933170902e-62dpy-30 domain-containing prote
in family protein (120 aa)
OxytrichaContig19024.0.g526.001122775063233e-17Dpy-30 motif
WormBaseWBGene000010880.0000000039998859049333245locus:dpy-30 Dosage compensa
tion protein dpy-30 status:C
onfirmed UniProt:Q10661 pr
otein_id:CAB01452.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00082260(coding)
ATGGAAGGCGAGTAGTTATAATAAGAAGGAACTAAAATTTAATCAAAAAGCAAGCCTATA
GATCCTGAATTTAATTTAGATGATGAAAAGGAAGCATAATATGTGGAAGCGAGAGCTTTA
GAAGATCAACCTTAAATAAATTTAAATGCTTTACCAACTAGACTTTATCTTGAAAAAGCA
ATTCTTCCTACTGTATACTAAGCATTAGAGGCTTTAGAAAAAGAAAGACCAATTAATCCT
ATAGAATTCTTTTCATATTATCTAATTACACATAATCCTTATTCTTAATAACATGCTAAA
GTACCCTTAAACAGTTAAGAATCAAAACCTGTTATAGCTCCAACTTAGGCTGAAATTAAA
TGA


>TTHERM_00082260(protein)
MEGEQLQQEGTKIQSKSKPIDPEFNLDDEKEAQYVEARALEDQPQINLNALPTRLYLEKA
ILPTVYQALEALEKERPINPIEFFSYYLITHNPYSQQHAKVPLNSQESKPVIAPTQAEIK


>TTHERM_00082260(gene)
ATGGAAGGCGAGTAGTTATAATAAGAAGGAACTAAAATTTAATCAAAAAGCAAGCCTATA
GATCCTGAATTTAATTTAGATGATGAAAAGGAAGCATAATATGTGGAAGCGAGAGCTTTA
GAAGATCAACCTTAAATAAATTTAAATGCTTTACCAACTAGACTTTATCTTGAAAAAGCA
ATTCTTCCTACTGTATACTAAGCATTAGAGGCTTTAGAAAAAGAAAGACCAATTAATCCT
ATAGAATTCTTTTCATATTATCTAATTACACATAATCCTTATTCTTAATAACATGCTAAA
GTACCCTTAAACAGTTAAGAATCAAAACCTGTTATAGCTCCAACTTAGGCTGAAATTAAA
TGA