Identifiers and Description

Gene Model Identifier

TTHERM_00079490

Standard Name

None

Aliases

PreTt10195 | 5.m00546 | 3828.m01459

Description

Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00036 ) EF hand
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00079490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06995.19.997093137033517e-262protein kinase domain-containi
ng protein (519 aa)
OxytrichaContig12409.0.0.g143.001413082154875e-142Protein kinase domain
DictyBaseDDB_G02715501.000371485572848e-69DDB_G0271550 on chromosome: 2
position 634463 to 636022
WormBaseWBGene000005539.996907204735647e-62locus:cmk-1 Calcium/calmodul
in-dependent protein kinase ty
pe 1 status:Confirmed UniP
rot:Q9TXJ0 protein_id:CCD718
65.1
Stentor CoeruleusSteCoe_208631.5400882849875202e-51
SGDYPL153C7.998505003885351e-50RAD53 Protein kinase, required
for cell-cycle arrest in resp
onse to DNA damage; activated
by trans autophosphorylation w
hen interacting with hyperphos
phorylated Rad9p; also interac
ts with ARS1 and plays a role
in initiation of DNA replicati
on

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00079490(coding)
ATGAGTGATATAATTAGCGGTGATACATAAAATGTCAAATTAGTAAAAACTAATTGTTCG
TAAAATGAGGAATACCAAATGAAATAACAGTTTATTGTAAATAAATAAATGTTTTTTAGA
TATTCTAATAAAAAAAAAATAAGAGATGACTATAAGTTTCTAAAAGAGCTAGGATCAGGA
GCCTTTGGTGTAGTATTCTTAGCTACTCATAGAATTACAGGAGATGAAAGAGCTGTAAAA
GCAGTAGCAAAAGATAGATTGTCTGATAAACAATAATTTTAGGATGAAATAAATATTTTA
AAAGAACTTGATCATCCTAATATTATAAAACTCTATGAAGTATATGAAAGCGAGTCCACA
ATTTATTTAGTAACAGAGTATTGTGAAGGTGGTGAATTATTTTAGTATGTTGTTTAAAAC
AAAAGACTCTAAGAAAAAGATGCTGCTTTAATTATGAGATAACTTTTCTCAGCAGTATCA
TATATTCATGATAATGGAGTAATTCATAGAGATTTAAAGCCTGAAAATTTTTTGCTTAAA
AAGAAGTCAGATCCAACAACAATAAAAATGATAGATTTTGGAATTTCTAAAAAATTCAAA
AAAGGAGAAGTTTTGAGACAATAATCTGGTACACCTTATTATATAGCTCCAGAAGTTATT
GAAGGATAATATAGTGAGTAAGTTGATAACTGGGCACTCGGAGTAATACTTTATATTTTG
CTTTCGGGAACACCTCCTTTTTATGGAAAAAATGCTTAAGAAATATTCTATTCAATAAGA
AAATGCAACTATAATTTAAATTTAAAAGCATTTTTAGAATGCAGCAATGAAGTGAGAGAT
TTAATATCAAGATTGCTGGTGAAGAATCCTAAAAAAAGACTCTGTGATATTGATTGTTAT
AACCATCCATGGGTGTAATAGTAAGTGAGCAGAGAAAATCAAAATTTAATTATTTCAAGT
GATTCTCTAGCAGGTTTAAAGAAAATAGTAGAACTTAAAAATATAAAAAAGACAATTCTC
ATTTATATGGCATCTCAGATATAGGACAGTGATTTAGATGTTTTGAAATAGATATTTGTT
AGTATGGACAAGGATGGAAATGGACGTATTAGTTTAGATGAATTAAAAGGAGGTCTTCAG
TTATTTAAAGAAAAATGTAATTTAGATTTTCAAGAGAGTGAAGTGAAACAGATCTTTTAA
GCAATGGATTTTGATAATAGTGGACAAATAGATTATTCAGAATTCATAGCAACATTTTTA
GCAAATCCTGAATTTTAAACTGATAAAGCCATCACATAAGCCTTTTTAAAAATTGATAAA
AATAATGATGGCAAAATTACAAGGCAAGAATTGCAAGATATTCTAGGAACTGATATAATA
TCGATCGGAGAAATTGATATCGACGAGCTCATAAAAGAAGCTGACACAAATGGAGATGGA
GAAATTGATTTTACTGAGTTTCTTACTATGCTAAGAGAAAAGAGAAATAAAAAGAGGAAG
AAAAGCAAATCTAAAGAACCAACTATCAATTTAATTGAAGGTTAAAACGATTAGTAATAA
CAACAAGACAAATGA


>TTHERM_00079490(protein)
MSDIISGDTQNVKLVKTNCSQNEEYQMKQQFIVNKQMFFRYSNKKKIRDDYKFLKELGSG
AFGVVFLATHRITGDERAVKAVAKDRLSDKQQFQDEINILKELDHPNIIKLYEVYESEST
IYLVTEYCEGGELFQYVVQNKRLQEKDAALIMRQLFSAVSYIHDNGVIHRDLKPENFLLK
KKSDPTTIKMIDFGISKKFKKGEVLRQQSGTPYYIAPEVIEGQYSEQVDNWALGVILYIL
LSGTPPFYGKNAQEIFYSIRKCNYNLNLKAFLECSNEVRDLISRLLVKNPKKRLCDIDCY
NHPWVQQQVSRENQNLIISSDSLAGLKKIVELKNIKKTILIYMASQIQDSDLDVLKQIFV
SMDKDGNGRISLDELKGGLQLFKEKCNLDFQESEVKQIFQAMDFDNSGQIDYSEFIATFL
ANPEFQTDKAITQAFLKIDKNNDGKITRQELQDILGTDIISIGEIDIDELIKEADTNGDG
EIDFTEFLTMLREKRNKKRKKSKSKEPTINLIEGQNDQQQQQDK


>TTHERM_00079490(gene)
ATGAGTGATATAATTAGCGGTGATACATAAAATGTCAAATTAGTAAAAACTAATTGTTCG
TAAAATGAGGAATACCAAATGAAATAACAGTTTATTGTAAATAAATAAATGTTTTTTAGA
TATTCTAATAAAAGTAACAAAAATATTACTTTTTCAGCTAATTTTAATACCAATTCTACT
TTTTAGAAAAAATAAGAGATGACTATAAGTTTCTAAAAGAGCTAGGATCAGGAGCCTTTG
GTGTAGTATTCTTAGCTACTCATAGAATTACAGGTTTGTGCTTAATAAATATAAATTTCT
ACTTTTTGCAATTTGCTAAATAATCATATAAAAATAAAAAATAATTGCTTGATCTATATT
AATTTTGAAAAATAAAATAAATAGGAGATGAAAGAGCTGTAAAAGCAGTAGCAAAAGATA
GATTGTCTGATAAACAATAATTTTAGGATGAAATAAATATTTTAAAAGAACTTGTAAGCT
CTCTCTTAAAAATAACAAATTTTATTTACTTTTATAATAGCAAATATATTATTTGTTTTT
TTAAATTATTAATATTCTTAAAATACAAGGATCATCCTAATATTATAAAACTCTATGAAG
TATATGAAAGCGAGTCCACAATTTATTTAGTAACAGAGTAAATATCTAAATCATTTAATT
CGTTTTAAAATATAATCCTATCAAATAAATATAACAGGTATTGTGAAGGTGGTGAATTAT
TTTAGTATGTTGTTTAAAACAAAAGACTCTAAGAAAAAGATGCTGCTTTAATTATGAGAT
AACTTTTCTCAGCAGTATCATATATTCATGATAATGGAGTAATTCATAGGTAAATATTCT
TGAAAAATTAATTATATTAATGAAAAATCTAATAAAAAGAGATTTAAAGCCTGAAAATTT
TTTGCTTAAAAAGAAGTCAGATCCAACAACAATAAAAATGATAGATTTTGGAATTTCTAA
AAAATTCAAAAAAGGAGAAGTTTTGAGACAATAATCTGGTACAGTAAGATAATTTATATC
GATAAAGTAATTAATTGAGTATTATACTTTAAAAAGCCTTATTATATAGCTCCAGAAGTT
ATTGAAGGATAATATAGTGAGTAAGTTGATAACTGGGCACTCGGAGTAATACTTTATATT
TTGCTTTCGGGAACACCTCCTTTTTATGGAAAAAATGCTTAAGAAATATTCTATTCAATA
AGAAAATGCAACTATAATTTAAATTTAAAAGCATTTTTAGAATGCAGCAATGAAGTAATC
AATTTTTTTTTTTGTGAGATTTTAATATATTTTAATCAAAGGTGAGAGATTTAATATCAA
GATTGCTGGTGAAGAATCCTAAAAAAAGACTCTGTGATATTGATTGTTATAACCATCCAT
GGGTGTAATAGTAAGTGAGCAGAGAAAATCAAAATTTAATTATTTCAAGTGATTCTCTAG
CAGGTTTAAAGAAAATAGTAGAACTTAAAAAGTAAATAAATAAATCTCTTAGAAATTCCA
AATCATTTTGTTTATTTTTAAATTTAAGTATAAAAAAGACAATTCTCATTTATATGGCAT
CTCAGATATAGGACAGTGATTTAGATGTTTTGAAATAGGTGAAATAATTATATTTATGCT
TTAAATTAAATATTTAATATCTAATTATAGATATTTGTTAGTATGGACAAGGATGGAAAT
GGACGTATTAGTTTAGATGAATTAAAAGGAGGTAATTAATTAATTAATTAATCAATAAAT
TAAGTAAATATTATATCCATAAACATAATAAAAATAGGTCTTCAGTTATTTAAAGAAAAA
TGTAATTTAGATTTTCAAGAGAGTGAAGTGAAACAGATCTTTTAAGCAATGGATTTTGAT
AATAGTGGACAAATAGATTATTCAGGTTTAAAAATTATTATTAATTTTTTGAAATTAACA
TTATTTTATAGAATTCATAGCAACATTTTTAGCAAATCCTGAATTTTAAACTGATAAAGC
CATCACATAAGCCTTTTTAAAAATTGATAAAAATAATGATGGCAAAATTACAAGGCAAGA
ATTGCAAGATATTCTAGGAACTGATATAATATCGATCGGAGAAATTGATATCGACGAGCT
CATAAAAGAAGCTGACACAAATGGAGATGGAGAAGTAATTATTGAAATTTTTAATTAAAA
TTGATGAACATATTAAAAATTAATTAGATTGATTTTACTGAGTTTCTTACTATGCTAAGA
GAAAAGAGAAATAAAAAGAGGAAGAAAAGCAAATCTAAAGAACCAACTATCAATTTAATT
GAAGGTTAAAACGATTAGTAATAACAACAAGACAAATGA