Identifiers and Description

Gene Model Identifier

TTHERM_000790949

Standard Name

ACT3

Aliases

None

Description

actin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_000790949

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05617.19.997093137033517e-262actin family protein (375 aa)
SGDYFL039C5.997217567989865e-168ACT1 Actin, structural protein
involved in cell polarization
, endocytosis, and other cytos
keletal functions
WormBaseWBGene000000649.997105718980434e-168locus:act-2 Actin-2 status
:Confirmed UniProt:P10984
protein_id:CAB04675.1
DictyBaseDDB_G02750231.0001254448791495e-166act22 on chromosome: 2 positio
n 5343575 to 5344705
OxytrichaContig19101.0.g495.997984985848154e-146Actin
Stentor CoeruleusSteCoe_221923.917469664450395e-64

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000790949(coding)
ATGTTTGATTATCCTGCCGTAGTTATTGATAATGGATCTGAAAGATGCAAAGCTGGTATA
GCTGGCGAATATGCTCCTAGAGCTGATTTTCCTTCAATAGTTGGTAGACCAAAATACTAA
AATTTAATGCTTTAAGGAAAGGAATTCTACATTGGAGATGATGCTTTAGCTAATAAAGCT
TTATTTAACTTATAATATCCTATTGAGAATGGTTTAGTTACTAACTATGATAACATGGAA
TAAATATGGCGTCATTGCTTTGATAATGAACTATAAGTTGATCCATCTCAGCAACCATGC
ATGTTGACTGAATCTGCCATGACTCCTAAGTTATACAGAGAAAAAATGACAAACATTATG
TTTGAAACATTCGATGTCCCTTCATTTTATGTATAAATTTAAGCAGTCTTATCTTTGTAT
TCTTCTTGTGGAGTTACAGGTATTGTTTTAGATTCTGGTGAGGGTGTCACAAATGCAGTT
CCTATATTTGAAGGATGTGCATTACGTCATGCTATATAGAAAAATTATTTAGCTGGTAGA
GATCTTACTGATTACTGCATGAAACTCATGTATGAAGTTGGTTTGAATTTTTAATCTTCA
GTTGAGAGGGAAGTAATAAGAGACATTAAAGAAAAATATTGTTATGTAGCACTCGATTAT
GAGGCAGAATTAAAGGCTTACTAAAATAACTCTTCTAAGCATAAATAATATCAATTTCCT
GATGGAAAAATGATCACAATTTAGGATTAAAGATTTAGAGTCCCTGAATTACTTTTCAAA
CCTGACTTTATTGGTAATGAATAAAAAGGAATAAGTGAATTAGCATTTCACTCCATTATG
AGCTGTGATATTGATCTTAGAAGAAATCTTTATGAAAATATTGTTTTATCTGGAGGTACA
ACTATGTTTGATGGTTTTGCAGAAAGAATATCCAAGGATATTAATGCTCTTGCTCCACTT
AGTATTAAAGCTGAAGTTATAGCTCTACCATAAAGAAAATACTCAGCTTTTATAGGTGGA
TCAATCTTATCATCTCTTTCTTCTTTCCAATCTAAATGGATTACTAAGGCTGAATATGAT
GAAGAAGGTACTTCAATTGTTCACAGAAAATGCTTTTGA


>TTHERM_000790949(protein)
MFDYPAVVIDNGSERCKAGIAGEYAPRADFPSIVGRPKYQNLMLQGKEFYIGDDALANKA
LFNLQYPIENGLVTNYDNMEQIWRHCFDNELQVDPSQQPCMLTESAMTPKLYREKMTNIM
FETFDVPSFYVQIQAVLSLYSSCGVTGIVLDSGEGVTNAVPIFEGCALRHAIQKNYLAGR
DLTDYCMKLMYEVGLNFQSSVEREVIRDIKEKYCYVALDYEAELKAYQNNSSKHKQYQFP
DGKMITIQDQRFRVPELLFKPDFIGNEQKGISELAFHSIMSCDIDLRRNLYENIVLSGGT
TMFDGFAERISKDINALAPLSIKAEVIALPQRKYSAFIGGSILSSLSSFQSKWITKAEYD
EEGTSIVHRKCF


>TTHERM_000790949(gene)
ATGTTTGATTATCCTGCCGTAGTTATTGATAATGGATCTGAAAGATGCAAAGCTGGTATA
GCTGGCGAATATGCTCCTAGAGCTGATTTTCCTTCAATAGTTGGTAGACCAAAATACTAA
AATTTAATGCTTTAAGGAAAGGAATTCTACATTGGAGATGATGCTTTAGCTAATAAAGCT
TTATTTAACTTATAATATCCTATTGAGAATGGTTTAGTTACTAACTATGATAACATGGAA
TAAATATGGCGTCATTGCTTTGATAATGAACTATAAGTTGATCCATCTCAGCAACCATGC
ATGTTGACTGAATCTGCCATGACTCCTAAGTTATACAGAGAAAAAATGACAAACATTATG
TTTGAAACATTCGATGTCCCTTCATTTTATGTATAAATTTAAGCAGTCTTATCTTTGTAT
TCTTCTTGTGGAGTTACAGGTAATTAATTAATTTACATATAATTGTGTAACTAATTAAAA
ATAATTAATTATCAGATTAAAAATTTAAATTTATTAAACATTTTTAAAAATATATTTTAG
GTATTGTTTTAGATTCTGGTGAGGGTGTCACAAATGCAGTTCCTATATTTGAAGGATGTG
CATTACGTCATGCTATATAGAAAAATTATTTAGCTGGTAGAGATCTTACTGATTACTGCA
TGAAACTCATGTATGAAGTTGGTTTGAATTTTTAATCTTCAGTTGAGAGGGAAGTAATAA
GAGACATTAAAGAAAAATATTGTTATGTAGCACTCGATTATGAGGCAGAATTAAAGGCTT
ACTAAAATAACTCTTCTAAGCATAAATAATATCAATTTCCTGATGGAAAAATGATCACAA
TTTAGGATTAAAGATTTAGAGTCCCTGAATTACTTTTCAAACCTGACTTTATTGGTAATG
AATAAAAAGGAATAAGTGAATTAGCATTTCACTCCATTATGAGCTGTGATATTGATCTTA
GAAGAAATCTTTATGAAAATATTGTTTTATCTGGAGGTACAACTATGTTTGATGGTTTTG
CAGAAAGAATATCCAAGGATATTAATGCTCTTGCTCCACTTAGTATTAAAGCTGAAGTTA
TAGCTCTACCATAAAGAAAATACTCAGCTTTTATAGGTGGATCAATCTTATCATCTCTTT
CTTCTTTCCAATCTAAATGGATTACTAAGGCTGAATATGATGAAGAAGGTACTTCAATTG
TTCACAGAAAATGCTTTTGA