Identifiers and Description

Gene Model Identifier

TTHERM_00077720

Standard Name

None

Aliases

PreTt10118 | 5.m00469 | 3828.m01382

Description

Serine/Threonine kinase domain protein; Protein kinase domain containing protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00077720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07059.19.997093137033517e-262protein kinase domain-containi
ng protein (638 aa)
OxytrichaContig11760.0.0.g745.0018479768654576e-80Protein kinase domain
DictyBaseDDB_G02799253.998181939598921e-51mlkA on chromosome: 3 position
2752719 to 2754560
WormBaseWBGene000005537.001220308967917e-48locus:cmk-1 Calcium/calmodul
in-dependent protein kinase ty
pe 1 status:Confirmed UniP
rot:Q9TXJ0 protein_id:CCD718
65.1
SGDYOL016C3.001129784945559e-41CMK2 Calmodulin-dependent prot
ein kinase; may play a role in
stress response, many CA++/ca
lmodulan dependent phosphoryla
tion substrates demonstrated i
n vitro, amino acid sequence s
imilar to Cmk1p and mammalian
Cam Kinase II
Stentor CoeruleusSteCoe_41114.906094730649281e-35

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00077720(coding)
ATGATCAACAGCTAAGTAAAAGCCTCTAAAGTGAAGGAATCGCTCTTCGATGATCTCGAT
TAAAATACTAGAGAATCTTACAAAATGTGGTCTAAAAATATACCTTTAATCCCAAAGAAG
ACTGATTAGAGGTCAATCGAAGGCACTCTTTTCAGAAAGTCGATTAAGAAAGGATATTGG
AAATCGAATACATACTAGCTTATTGGTAATAAGTTGATAAAATTTACAGCTGAAAGCGGT
AAACCTGAGAAATTTGCTAACATTGAAAATTATCGTCTTGAGAAAATAAAACTTGAAGAA
AAGGGAGACAAAGATATTAAGTATGGATTTCGTTTGACACATAATTGCAAATTTGTGGAA
TTATACGCACGTAATAAAGAACATATGCTTATGTGGTTTGAATTAGTCAAGCGTTAGTGT
GTATTAACTACATTTTAGAATGATTATTCTACTATTAAGCTTATGGGCAAGGGTAATTTT
GCTCGTGTTTATTATGCGCGTTCAAAGCTAACTGGAGGAGAATTTGCAGTAAAGGCATTT
GAAAAAGATAAATTTGCTCAAATTGAGATTGACAGACCAGCATTGATTAAGGAAATTTCA
ATTTTACGTAAGATGAATCATCCTGGTGTCATTAAAATGTATGAAGTTTATGAGAACGAA
ACTCATATTTTCTTAGTTAATGAATTGTTAAAGGGAGGAGAATTATTCCACAAGTTAAAA
GGCCATGGGTAATTTGACGAAGTTTATGTTGCTTAACTAATGACGACTCTCCTCGACTCA
ATTCATTACATTTCTCAAAGAAACATATTGCATCGTGATATTAAACCTGAAAACCTTATC
CTACGTTCTAAAAACAACGATACTGACTTGTGCTTAGCTGATTTTGGTTTGGCTGATTAC
TACGATCCTAAGGGAGGATACATGTTCCAGCGCTGTGGCACTCCTGGATACGTCGCACCT
GAAGTTCTTGCTGATAAGATTTACGATTTTAAGGTAGACACATTCTCTGCAGGTGTAATA
ATGTTCATACTTTTAACAGGTAGCTCTCCGTTCAAAGGAAAATCTTATGACGAAATTGTA
ATCAAAAATTACAATTGCACTATCGACTTTAATTACAATGAAATGGGCAAATATTTATCG
GCTGAGTGCTTTGACTTACTTTAGAAGCTGCTCAAAAAAGATCCTCTAGAGCGTTATTCA
GCAATATAAGCTCTCAATCATCCTTGGTTTGCAAAAATGAAGGCTGCAACTCCCACTACC
TAATAGAAATCGAGCGTTGTTTCTTCTCAGACTTCATTAGAAGGAGATTAAATAGTACGC
ATTGCACCAAAGGATAATTTACAATTAAAGAGTAAGACTCCACTAATGAATAGCAAGTGG
TCTGAGCCATAGGAATAGCAAAGTCCCGAAACTTGGAAAAAATAATAATAATAAGGCAGA
AACTCTGTTAGTGAATATATTGATAGTCCTATGAGTCGTCAAGCTTAAGATTCTCCATAG
ATTAAAACTCCAGGAGGAAGCTAATACAGCCAGCCCTTCAAGAAAACACCAGATTCTAAT
GGTAGCTCTAAAATAAAGCAAGAAACTCCTGTGATAAAAATGTAGTCCGTACCTGAATGC
ATGGATGAATATGATATCGATCCTAGCTCCTTGGAAGATGCACATTCTCCCTTAATTGAA
AACATGAAAAACCTATAAAAATATGACCTTAATAACAAGAATTCTAAAAAATTCAAAGAA
GTCTATCAAAGTCCTATAATAAAAAATCCTTCTAACTTGTTCTCTAATGGAAACTAGTAA
CAAGGGCAATAAGTAAATAATTTAACTCAAAATCTAAATGCATCTAATAACACAAACTAA
GATGTTAAGAATACAAAGTCAATCCGTGAAAAATTAATATAAAATGTGTGA


>TTHERM_00077720(protein)
MINSQVKASKVKESLFDDLDQNTRESYKMWSKNIPLIPKKTDQRSIEGTLFRKSIKKGYW
KSNTYQLIGNKLIKFTAESGKPEKFANIENYRLEKIKLEEKGDKDIKYGFRLTHNCKFVE
LYARNKEHMLMWFELVKRQCVLTTFQNDYSTIKLMGKGNFARVYYARSKLTGGEFAVKAF
EKDKFAQIEIDRPALIKEISILRKMNHPGVIKMYEVYENETHIFLVNELLKGGELFHKLK
GHGQFDEVYVAQLMTTLLDSIHYISQRNILHRDIKPENLILRSKNNDTDLCLADFGLADY
YDPKGGYMFQRCGTPGYVAPEVLADKIYDFKVDTFSAGVIMFILLTGSSPFKGKSYDEIV
IKNYNCTIDFNYNEMGKYLSAECFDLLQKLLKKDPLERYSAIQALNHPWFAKMKAATPTT
QQKSSVVSSQTSLEGDQIVRIAPKDNLQLKSKTPLMNSKWSEPQEQQSPETWKKQQQQGR
NSVSEYIDSPMSRQAQDSPQIKTPGGSQYSQPFKKTPDSNGSSKIKQETPVIKMQSVPEC
MDEYDIDPSSLEDAHSPLIENMKNLQKYDLNNKNSKKFKEVYQSPIIKNPSNLFSNGNQQ
QGQQVNNLTQNLNASNNTNQDVKNTKSIREKLIQNV


>TTHERM_00077720(gene)
ATGATCAACAGCTAAGTAAAAGCCTCTAAAGTGAAGGAATCGCTCTTCGATGATCTCGAT
TAAAATACTAGAGAATCTTACAAAATGTGGTCTAAAAATATACCTTTAATCCCAAAGAAG
ACTGATTAGAGGTCAATCGAAGGCACTCTTTTCAGAAAGTCGATTAAGAAAGGATATTGG
AAATCGAATACATACTAGCTTATTGGTAATAAGTTGATAAAATTTACAGCTGAAAGCGGT
AAACCTGAGAAATTTGCTAACATTGAAAATTATCGTCTTGAGAAAATAAAACTTGAAGAA
AAGGGAGACAAAGATATTAAGTATGGATTTCGTTTGACACATAATTGCAAATTTGTGGAA
TTATACGCACGTAATAAAGAACATATGCTTATGTGGTTTGAATTAGTCAAGCGTTAGTGT
GTATTAACTACATTTTAGAATGATTATTCTACTATTAAGCTTATGGGCAAGGGTAATTTT
GCTCGTGTTTATTATGCGCGTTCAAAGCTAACTGGAGGAGAATTTGCAGTAAAGGCATTT
GAAAAAGATAAATTTGCTCAAATTGAGATTGACAGACCAGCATTGATTAAGGAAATTTCA
ATTTTACGTAAGATGAATCATCCTGGTGTCATTAAAATGTATGAAGTTTATGAGAACGAA
ACTCATATTTTCTTAGTTAATGAATTGTTAAAGGGAGGAGAATTATTCCACAAGTTAAAA
GGCCATGGGTAATTTGACGAAGTTTATGTTGCTTAACTAATGACGACTCTCCTCGACTCA
ATTCATTACATTTCTCAAAGAAACATATTGCATCGTGATATTAAACCTGAAAACCTTATC
CTACGTTCTAAAAACAACGATACTGACTTGTGCTTAGCTGATTTTGGTTTGGCTGATTAC
TACGATCCTAAGGGAGGATACATGTTCCAGCGCTGTGGCACTCCTGGATACGTCGCACCT
GAAGTTCTTGCTGATAAGATTTACGATTTTAAGGTAGACACATTCTCTGCAGGTGTAATA
ATGTTCATACTTTTAACAGGTAGCTCTCCGTTCAAAGGAAAATCTTATGACGAAATTGTA
ATCAAAAATTACAATTGCACTATCGACTTTAATTACAATGAAATGGGCAAATATTTATCG
GCTGAGTGCTTTGACTTACTTTAGAAGCTGCTCAAAAAAGATCCTCTAGAGCGTTATTCA
GCAATATAAGCTCTCAATCATCCTTGGTTTGCAAAAATGAAGGCTGCAACTCCCACTACC
TAATAGAAATCGAGCGTTGTTTCTTCTCAGACTTCATTAGAAGGAGATTAAATAGTACGC
ATTGCACCAAAGGATAATTTACAATTAAAGAGTAAGACTCCACTAATGAATAGCAAGTGG
TCTGAGCCATAGGAATAGCAAAGTCCCGAAACTTGGAAAAAATAATAATAATAAGGCAGA
AACTCTGTTAGTGAATATATTGATAGTCCTATGAGTCGTCAAGCTTAAGATTCTCCATAG
ATTAAAACTCCAGGAGGAAGCTAATACAGCCAGCCCTTCAAGAAAACACCAGATTCTAAT
GGTAGCTCTAAAATAAAGCAAGAAACTCCTGTGATAAAAATGTAGTCCGTACCTGAATGC
ATGGATGAATATGATATCGATCCTAGCTCCTTGGAAGATGCACATTCTCCCTTAATTGAA
AACATGAAAAACCTATAAAAATATGACCTTAATAACAAGAATTCTAAAAAATTCAAAGAA
GTCTATCAAAGTCCTATAATAAAAAATCCTTCTAACTTGTTCTCTAATGGAAACTAGTAA
CAAGGGCAATAAGTAAATAATTTAACTCAAAATCTAAATGCATCTAATAACACAAACTAA
GATGTTAAGAATACAAAGTCAATCCGTGAAAAATTAATATAAAATGTGTGA