Identifiers and Description

Gene Model Identifier

TTHERM_00077020

Standard Name

None

Aliases

PreTt10048 | 5.m00399 | 3828.m01310

Description

hypothetical protein; Neurohypophysial hormones- N-terminal Domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03107 ) DC1 domain
  • ( PF07337 ) DC-EC Repeat
  • ( PF07699 ) GCC2 and GCC3
  • ( PF00008 ) EGF-like domain
  • ( PF02822 ) Antistasin family
  • ( TIGR01612 ) rhoptry protein
  • ( PF01754 ) A20-like zinc finger
  • ( PF09257 ) BCMA, TALL-1 binding
  • ( PF08067 ) ROKNT (NUC014) domain
  • ( PF08792 ) A2L zinc ribbon domain
  • ( PF00757 ) Furin-like cysteine rich region
  • ( PF06424 ) PRP1 splicing factor, N-terminal
  • ( PF03860 ) Domain of Unknown Function (DUF326)
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR01053 ) zinc finger domain, LSD1 subclass
  • ( PF07554 ) Uncharacterised Sugar-binding Domain
  • ( PF07754 ) Domain of unknown function (DUF1610)
  • ( PF09297 ) NADH pyrophosphatase zinc ribbon domain
  • ( PF03302 ) Giardia variant-specific surface protein
  • ( PF00172 ) Fungal Zn(2)-Cys(6) binuclear cluster domain
  • ( PF00220 ) Neurohypophysial hormones, N-terminal Domain
  • ( PF06011 ) Transient receptor potential (TRP) ion

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.6%

TetraMine Data

TTHERM_00077020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07124.29.997093137033517e-262neurohypophysial hormone, N-te
rminal Domain containing prote
in (2201 aa)
OxytrichaContig12863.0.g1081.000159011384939e-43Protocadherin
Stentor CoeruleusSteCoe_96518.75651076269652e-27
WormBaseWBGene000022990.0000020007268868677913locus:let-23 status:Partiall
y_confirmed UniProt:B5BM27
protein_id:CAR31509.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00077020(coding)
ATGTAAGTAATTGATTAGTAAATTGAGCTTAAAAATTTAGTTCTAGTTGAAGAAATATTT
ATTTCTTTATCTATATTATCAAGCAAATAATTGTAAATTGATATTAAATAAAAGCCTGCT
TATTATGTTGGCTTTGAGGCATTTATGGGTGATGATTGGGATATAGAAGAAGCTAAATCA
TGGACAGTTACTAATACTTAATGTCCTAAAACAAAATATTCAGTCACCCGTTGCGGGAAA
ACATAAATTTTGGGAGGATACAATTGCTTGGCAGAAAACGCATAAATATCAAGGAGTTTT
ACTTTGCCTCACCACTGGTCTATATATATAAAAGTCACTTTCTGGCTGATTGATTCATGG
GACTCCGAGTATTTAATTATGAAACTTGGTAACATAGAGATCAAAGAATTAAGAGAACAT
TCTCCTTACGATGACAATTTATGCGGGGCAACAGGTAATTGGGCAGGTTTAAATAAATAA
GCATATTTAGATAGAAAATATGATAAAACTCTAGAAAATAATCCTCATTATGAAAGAGCT
GTCACTGCAGTTTTTACTTCAAATCTTGATGGTAAAGCAGATGATGAAAGTTTTGGGATT
AATAATTTTTAGCTATTAATTGATCCATGTAATCCTACTTGCAATTAATGTCTTTTGGGA
CCTGAATCATTTAATTGCTTGAACTGCTGGGACAATGCTACATTCATCAAGTATAAAGAA
GATTATATTTTATGCACATGCAGCCCTACAGAGTTTTATTATGCTAAGAAAGGATAAAAG
TGCAAAAAAGATTGCCCTATTACAAGTTCTTAATAAGGATTTTGTAAATGCAATTAAGGA
TATTATACAGTATCTAAGAATGTTCCATGCAATGATCCAATTTGTACTGAATGCAAAAAA
TGCGATTCTACATGCAAAGATTGCTCTGGTTCAGGTCCCTATAACTGCATTACATGTGCG
AATAATCTTTATAAGTAGACTTATGCTGCTCCAGATGTACCTTCAACTCATCCAAACTAT
GGAAAAACTATTTGTTAAGATAAATGCTTAGACGAAAGCTATTTTATAGATTAAGTTAGA
AAAGAATGCATGAAATGTCATCCTTCTTGCAAAACTTGCGTTGGAGATCTATCTTAAGAG
TGCTTATCATGCCCAGATGGCTTTTATCTTGATGGAAATGATATTGGAGGTGGAGTTTTT
GTAGGTGGTTGTGTTTCTAAGTGCTCTTAAGGGTATTATAAGAATACTTTAAATAAAAAA
TGCATGAGATGCAATATTAACTGTATTGACTGTAAAGATGATCAACCAGATTATTGTACC
GAATGCAAAATAAAACTTTTATGGAAGGATGGAACATGCTATTAAAATTGCCCAGATGGG
TATTGGAATGATACTCCTAACAAAATGTGTAGAAAATGTGATTAAAAATGCAATACTTGC
TTAGGAAGTCCTACTTTTTGTACATCTTGTAATGGGGATTATTATTATTTAGAAAAATAA
AATGACTGTTTAAAGGATAAATGTCCTGATGGAATGTTTAAATACAAAGACGCTTCCAAA
GGGCTTAATTTTTGCCAGAAATGTCACATGAATTGCTTAACTTGTTTCGCTGGAGATATA
GATAATTGTTTAAGTTGTGATCCTGCTGTTGGGTTTTTGAAAGGGAATGTTTGTGCTGCA
TGTAATTCAAATTAATATGGAGACACAAAAGATTAAACATGTAAGCCTTGTAACTTAAAT
TGTACAACTTGTGAAGGGCCTAATGACGATTAGTGCAGGAGTTGCTCTGGATCGTTATTT
TTAAAAGATAAAAAATGTAATCCGACATGTCCAGATTAAACTTATCCAGATATTTCAACT
CATGAATGCGCTCCTTGTGATAGTACTTGTTATAAATGTTCATCTGCTGGTCCAAATAGT
TGCAAATCATGTCCTTCTGGTAGATTTTTGAAAGGAACTGTTTGTTAAACAACTTGCGAT
ATAGTTGGAGAATATCCTGACACTACCAACAACGTTTGTGGTACTTGTAATTCAGAATGC
TTAAAATGTAAGGATGGTACAAAATTAGGTTGCATAGAGTGTTCTTCAAGTAAATATTTA
CAGGTAAACTAGTGTGTTGACAGTTGTCTTTCTAATTTGTTTGGGTTAGAGGAAACAAAG
TAATGCTTAGAAGAGTGCCCTTAAGGATATTATGGTGATTCAGTTAGCAAAAAATGTCTT
AAATGTGAAGCATTTTGCCCTATTTGCAAAGCATCAGGTTTTAGTAATTGTGAGAAATGT
GCTGGAGATTTATTCTTATAAGATAGTTAATGCCTAAAATAGTGCAAAGATGGTTTTTAT
GCAGATAAAACTGACAATATTTGCAAAAAATGTCACGATAACTGTCTAGAATGCTAAGCT
GGTACTGAAAATGACTGCACAAAGTGTAAGAGTAAGCAGTTTTTAGGATAAAATACATGT
TATACTAAATGTCCTAACAAATAATATGGAAATTAAGTTAATATGAACTGTGTTTAGGAA
TGTCCTCTTGGAACTTATGGAAATTAATATGAAAATTTATGTAGAGCTTGTCATAGTAAC
TGCTCTCAGTGTTATGGTTCTTCTTATTCTTAATGCTACAAGTGCAATTTAGGACACTAC
TTGCTTGATAGTACTTGTGATTTATGTCCATCTGGATATTACAAAAATGATCAATAAAGA
ACTTGTGATCCATGCTTTGATAACTGTACTTAATGTGATGGAGGATCTCCCTCAGATTGC
TTGAAATGTGCCTATGGCTATTACCATTTAAAAGAATAAAAAATGTGTGTATCAACATGT
CCTGACCCTTACTACTCAGAAGAAAATAATCCTGATTGCATTCTTTCTTGTACTCAGTCT
AATTAATATCCCAATAATATTACTAGAAAATGTGAAAATTGCAATATTGCTTGCAAAGAA
TGTTTTGGATCAGATGAGTCCAGCTGCAAGAAATGTTCAACAAACTACCTATTTTTAGAA
AAAAGAAATATGTGCACAAAAAAATGTCCTTATGGATATTATGAAAATTATATAACTTTT
ACCTGTGATCCTTGTGATAAAACGTGTTAAACTTGCTATGGTGGATCCCCAGATTAGTGT
ATTTCATGCAGAGAACCTAATTTCTTATTTTAAAATTATTGCACTGATACTTGTCCTCAA
AATTTATATAAAGACCTTGAAATATTAAAATGTGTTGAAGATTGCACACAATACAAATCA
AATAGATTTGCAAATTAATTAACAAGAAATTGCTAGTTTTGCCATTCATCATGCCAAAAA
TGTACAGGACCAACCAATAAGGAGTGCACTTAATGCACTTCTTCTCACCTTCTTCTTGGA
ACTAGTTGCTTAGATACTTGTCCATTAGGATATTACGCTGTCTATAAAGACCCAAATTTA
AAGAATTCAGATTAAATTAAAGTAACTGATGATTGTTAAAAATGTCATTAAAATTGCGAG
GACTGTTATGGACCGTCTGAGAGTGAGTGTAGAACATGCTCAAAAGGTCTTTATACTTAT
CATGCTCCCTCAATAGAAAATTAAGGAATTGAAAAGAAAACTTGTGTTGCCCAATGTCCA
GACCAATATATAGTAAATCACTAAAATATGTCTTGCGAATTATGTCCACCTTACACTTTT
TTCGAAAATGGAGTTTGCAAAAATTGTCATTATTCTTGCATTAAGTGCAAAGGACAAACC
TAATTTGATTGCATTAAATGCACTTCTGAAAGATCAATTTATAATGAAGGTGAACCTTTA
AATGGATAGTGCAACTGCAAATAAGGTTATATGGAAACATTTTCTCATGAATGCTCATAG
CTTCCTATTATAGCTACGTCTATGAGTAAGTCTATTTTTGTTTCTCTTTTGACTTCTTTA
TCTTGCTCTATCATTACTGGATTACTCAGCACCTCTGCATTTTCTTTCCATCAATTAATA
GAAGCTTCATATTACACTGGTTATCTTAAATTTGCTAATGTTACTTATCCTTTAAACTTA
CATTATTTATTTGAGAGTGTTTCCACAGATTAAAGCAATCAAATCTTCGAAAATAAAAGT
TAAACTTCCACATAAATAAAAGACAAATCAAGAATTTTAATAAGTAAGACAGAGTTGTTG
CAATCTTAAGAAGTTGGAGAAGCTCCTTAGGTGTGGAAAAAATTCATATTCACTTTAGTT
ATAAATATATCTTCTTGGTTTATTGTGCTCATACTCAATTTAGCAGTAATTCATATGAAA
GTAAAGTATAATTAGCAAAATAAATTAGAAAAAGTAAGGGTACTACTGTAGTATACTCTT
CCAATTTAAGCTTTTTTAAGGACATCACAAGAGGCATTTTAGTTTATCTTTCTCAGTGCC
TATTTTAGTGCAACTTTGGATGTGTTTGGATGGCTAAATTTTGTATACATATTAATTACT
ATGCTTGTAGTATTTGGGATTATAATCAAATTATCTTTCCTATAACTTAATGAAAAAAAA
TCAGATACTTCAGATAAAGGAGCTGGAGAATATTTTATAAGGGTGAAAGTAAAAAAAAAT
AAAACTATAGATTATCCCCATCCTCTGAGAACGCTTTTATATTTTTTTAAAGACAATAAA
TTTGCTAGAAATTATTACACCTTAATGCTACTTTTCAAATTTTCAAATGTGTTTGTAATT
GTTTTTACTAGCAATATTGTGATTTAAATGGTAATTATGATCATAACAAAATTACTTTTT
GTTATTTACTTGATTATTTGCAAGCCATTTAAATAAAAAAATTATAATTACATCAATATT
TTTAATGAAATCCTCTCTTGCTCTATTCCTTTAACTATTTTAATCATGGCTAAATCTGAA
GAAAATGAAGCTAACTATAATGCTTTTGGCTGGTTAATATTTGTTGAAATGATCATTCTA
TTTTTGTTTAACTTTATATATGCAGTTTTTGAACTTGTAATGATGCTAAAGATTTATATA
ACCAAAAAACTTAAATTCTCAAAAAGATTTATAAAAATAAACTCAGAAAAATAATCAGAT
TCTGCTGATTAATCAGCTGATAACCAGTCTGTTTTGTTTGAAAAAAATGTTTTAAAAAAT
ATTTAAAATGTCCCACTGAGGATAGAAGAAAAAAATGATTTTGATAAGTAAAACTCGCCT
GTGAAATAACATACGAAGAATAATCACTTGAAAGTATTGCAAATTGGCTAAACAAATTAG
AATCTACAGTCAAGTTGCTAATCAATAGAAGGTCCTTCAATCCAAGCTACAGGTACAAGA
AAAAACATTGTTCATCCAGAATGTACAATAGAGATTGATAAATCCTAGTTAGAAAACTAA
AATCAATCTTCAGTTTCTAAGTCATACAATTAATAAGAAGGCGATGAAGAAGATTTCAAT
CTAAATTCATCAAATGTCAAAGCATAGTCTATCCTTAAAGAAGATTATGAGTATGATGAA
AACAGTGAAAACATGGGATTCCCACTTTCAATTTATGGTAAATAGCTGGAATAAAATCAA
GCAAAATCACCTTTGAAAAGAAAAAAAAGAAATAAAAAAAAAGATGAATAAAAAGTATAA
TTTGCTTAGGAATAAGAAGACATAACAAACAAAAAGTCTTTGGAGAATCAGACTAATTCG
GCAGAAGTTAGCTCTTAAAATAATACAGTAAAATCTAAGTAAGAGGAAGAAGATGAATAG
AAGTAGCAGCATATATCTTAAGTTATAGAGAATGTTAATGATAAGTTATTAAAAAGCAAC
AATGGAAATATTCAACCAAAAAATATTACTGAAAGAACTTCACTTGATCTAATTAAGGTG
ATTGAGTAAGAATCTAATTCTTGGGGATTAAAGAAAAAACTATCAATAAAATAAAAGCTT
TAAAAAATGTAATAAAATCCTTAAAAAGAAGTTATTGAGGATATTGATGAATCTAATGGA
GAAAAAGTTATCACATAAGTTATTACTAAGTAAAAGAGTGATAGAAGTAGAACAAGTGAT
ATAGTTTTAAATTCAAGTAAAAGGTAAAAGGAAGATAATTCTTTGAAAATAATAGAATTA
AATTAGGACTAGAAATCTAATTAAGCTCAGCAATAATAACAAATTTTTGAAGAAAATGAG
ATCAAAATTAATTCATAAAAATAAATTTAAAACTAAAACAAAAATTAAAAAAATTAAAAT
ATTAAAAACTCAAGTTTGAAAGATTCAAAATCTAGTAAATTAAATAATGACAGTAAAATA
TCAAATGAAAATAAAAAAGACAATATAGTTTTTAGAAATGAAGGATTATTTGGAGGCATA
AGCGAGTTTAAAATAAAAAGGGTTGTTTAATCTTAAAGTACTAACACTAGTCCTTTGAAA
AAAGTAGATTCTAGACTCAAAGAAGATAAAGAAGATGAATCTAAGTCAATACTAGATTTT
ATTAAACAGAAAGTTATCAAATAAAACTTGTTTAAAGAATCAAAATGA


>TTHERM_00077020(protein)
MQVIDQQIELKNLVLVEEIFISLSILSSKQLQIDIKQKPAYYVGFEAFMGDDWDIEEAKS
WTVTNTQCPKTKYSVTRCGKTQILGGYNCLAENAQISRSFTLPHHWSIYIKVTFWLIDSW
DSEYLIMKLGNIEIKELREHSPYDDNLCGATGNWAGLNKQAYLDRKYDKTLENNPHYERA
VTAVFTSNLDGKADDESFGINNFQLLIDPCNPTCNQCLLGPESFNCLNCWDNATFIKYKE
DYILCTCSPTEFYYAKKGQKCKKDCPITSSQQGFCKCNQGYYTVSKNVPCNDPICTECKK
CDSTCKDCSGSGPYNCITCANNLYKQTYAAPDVPSTHPNYGKTICQDKCLDESYFIDQVR
KECMKCHPSCKTCVGDLSQECLSCPDGFYLDGNDIGGGVFVGGCVSKCSQGYYKNTLNKK
CMRCNINCIDCKDDQPDYCTECKIKLLWKDGTCYQNCPDGYWNDTPNKMCRKCDQKCNTC
LGSPTFCTSCNGDYYYLEKQNDCLKDKCPDGMFKYKDASKGLNFCQKCHMNCLTCFAGDI
DNCLSCDPAVGFLKGNVCAACNSNQYGDTKDQTCKPCNLNCTTCEGPNDDQCRSCSGSLF
LKDKKCNPTCPDQTYPDISTHECAPCDSTCYKCSSAGPNSCKSCPSGRFLKGTVCQTTCD
IVGEYPDTTNNVCGTCNSECLKCKDGTKLGCIECSSSKYLQVNQCVDSCLSNLFGLEETK
QCLEECPQGYYGDSVSKKCLKCEAFCPICKASGFSNCEKCAGDLFLQDSQCLKQCKDGFY
ADKTDNICKKCHDNCLECQAGTENDCTKCKSKQFLGQNTCYTKCPNKQYGNQVNMNCVQE
CPLGTYGNQYENLCRACHSNCSQCYGSSYSQCYKCNLGHYLLDSTCDLCPSGYYKNDQQR
TCDPCFDNCTQCDGGSPSDCLKCAYGYYHLKEQKMCVSTCPDPYYSEENNPDCILSCTQS
NQYPNNITRKCENCNIACKECFGSDESSCKKCSTNYLFLEKRNMCTKKCPYGYYENYITF
TCDPCDKTCQTCYGGSPDQCISCREPNFLFQNYCTDTCPQNLYKDLEILKCVEDCTQYKS
NRFANQLTRNCQFCHSSCQKCTGPTNKECTQCTSSHLLLGTSCLDTCPLGYYAVYKDPNL
KNSDQIKVTDDCQKCHQNCEDCYGPSESECRTCSKGLYTYHAPSIENQGIEKKTCVAQCP
DQYIVNHQNMSCELCPPYTFFENGVCKNCHYSCIKCKGQTQFDCIKCTSERSIYNEGEPL
NGQCNCKQGYMETFSHECSQLPIIATSMSKSIFVSLLTSLSCSIITGLLSTSAFSFHQLI
EASYYTGYLKFANVTYPLNLHYLFESVSTDQSNQIFENKSQTSTQIKDKSRILISKTELL
QSQEVGEAPQVWKKFIFTLVINISSWFIVLILNLAVIHMKVKYNQQNKLEKVRVLLQYTL
PIQAFLRTSQEAFQFIFLSAYFSATLDVFGWLNFVYILITMLVVFGIIIKLSFLQLNEKK
SDTSDKGAGEYFIRVKVKKNKTIDYPHPLRTLLYFFKDNKFARNYYTLMLLFKFSNVFVI
VFTSNIVIQMVIMIITKLLFVIYLIICKPFKQKNYNYINIFNEILSCSIPLTILIMAKSE
ENEANYNAFGWLIFVEMIILFLFNFIYAVFELVMMLKIYITKKLKFSKRFIKINSEKQSD
SADQSADNQSVLFEKNVLKNIQNVPLRIEEKNDFDKQNSPVKQHTKNNHLKVLQIGQTNQ
NLQSSCQSIEGPSIQATGTRKNIVHPECTIEIDKSQLENQNQSSVSKSYNQQEGDEEDFN
LNSSNVKAQSILKEDYEYDENSENMGFPLSIYGKQLEQNQAKSPLKRKKRNKKKDEQKVQ
FAQEQEDITNKKSLENQTNSAEVSSQNNTVKSKQEEEDEQKQQHISQVIENVNDKLLKSN
NGNIQPKNITERTSLDLIKVIEQESNSWGLKKKLSIKQKLQKMQQNPQKEVIEDIDESNG
EKVITQVITKQKSDRSRTSDIVLNSSKRQKEDNSLKIIELNQDQKSNQAQQQQQIFEENE
IKINSQKQIQNQNKNQKNQNIKNSSLKDSKSSKLNNDSKISNENKKDNIVFRNEGLFGGI
SEFKIKRVVQSQSTNTSPLKKVDSRLKEDKEDESKSILDFIKQKVIKQNLFKESK


>TTHERM_00077020(gene)
ATGTAAGTAATTGATTAGTAAATTGAGCTTAAAAATTTAGTTCTAGTTGAAGAAATATTT
ATTTCTTTATCTATATTATCAAGCAAATAATTGTAAATTGATATTAAATAAAAGCGTAAT
TTAATTACATTTTAATTAGAAAACTATTTATATTTGCTACAATGAGTCTTCTTAATTTTC
ATCAATTTTTATTATTTTGTAGCCTTTTTTTCATTGCAAAGCGTAAGCATTTTTTAAAAA
CTTGAATTTCATATCAATAGAGCATATTTTTTTCATTAGCTGCTTATTATGTTGGCTTTG
AGGCATTTATGGGTGATGATTGGGATATAGAAGAAGCTAAATCATGGACAGTTACTAATA
CTTAATGTCCTAAAACAAAATATTCAGTCACCCGTTGCGGGAAAACATAAATTTTGGGAG
GATACAATTGCTTGGCAGAAAACGCATAAATATCAAGGAGTTTTACTTTGCCTCACCACT
GGTCTATATATATAAAAGTCACTTTCTGGCTGATTGATTCGTACTTAATTTTTACTAATT
TCAAGACTAAAAATAATTAAACTTTAATCATAAAATTATAGATGGGACTCCGAGTATTTA
ATTATGAAACTTGGTAACATAGAGATCAAAGAATTAAGAGAACATTCTCCTTACGATGAC
AATTTATGCGGGGCAACAGGTAATTGGGCAGGTTTAAATAAATAAGCATATTTAGATAGA
AAATATGATAAAACTCTAGAAAATAATCCTCATTATGAAAGAGCTGTCACTGCAGTTTTT
ACTTCAAATCTTGATGGTAAAGCAGATGATGAAAGTTTTGGGATTAATAAGTAAAAATTT
CATCTTCAAATAATAAAATAAATTTAAATTCAAATTTTTTGTTTTACTTTTAATTGTTTT
AATGTAAAAAATAGTTTTTAGCTATTAATTGATCCATGTAATCCTACTTGCAATTAATGT
CTTTTGGGACCTGAATCATTTAGTAATTAATTAAATAAATTAAAAATTAATTAATTAAAT
GAATTAATGAATTTAAAATTAATTAGATTGCTTGAACTGCTGGGACAATGCTACATTCAT
CAAGTATAAAGAAGATTATATTTTATGCACATGCAGCCCTACAGAGTTTTATTATGCTAA
GAAAGGATAAAAGTGCAAAAAAGATTGCCCTATTACAAGTTCTTAATAAGGATTTTGTAA
ATGCAATTAAGGATATTATACAGTATCTAAGAATGTTCCATGCAATGATCCAATTTGTAC
TGAATGCAAAAAATGCGATTCTACATGCAAAGATTGCTCTGGTTCAGGTCCCTATAACTG
CATTACATGTGCGAATAATCTTTATAAGTAGACTTATGCTGCTCCAGATGTACCTTCAAC
TCATCCAAACTATGGAAAAACTATTTGTTAAGATAAATGCTTAGACGAAAGCTATTTTAT
AGATTAAGTTAGAAAAGAATGCATGAAATGTCATCCTTCTTGCAAAACTTGCGTTGGAGA
TCTATCTTAAGAGTGCTTATCATGCCCAGATGGCTTTTATCTTGATGGAAATGATATTGG
AGGTGGAGTTTTTGTAGGTGGTTGTGTTTCTAAGTGCTCTTAAGGGTATTATAAGAATAC
TTTAAATAAAAAATGCATGAGATGCAATATTAACTGTATTGACTGTAAAGATGATCAACC
AGATTATTGTAAAATATTCTACAAATATTAAATGCATTTCTTATTTAATTATTAAAAAAT
CAATAAAAAATATCTACTGTGTAACAAAAATAAAAAAGTTTTGATTAGGCTAGTTTAAAA
TCAATTTTATGATATTTTGCTTGACCTACTATTTTCTTTTGCATGCTATATTCATGAGAA
TAAATTCATTTAAAAAATAAATAAATAAATTCAAAAAACAAAATAAATAAACATTTTTAA
ATTAAAATGAAATTATAGTGGACAATTATTATTATTAAATATTTTTCTAAAAATAAGTTA
ATAATATTTGTTTCATTTTATGTTAGGTACCGAATGCAAAATAAAACTTTTATGGAAGGA
TGGAACATGCTATTAAAATTGCCCAGATGGGTATTGGAATGATACTCCTAACAAAATGTG
TAGAAAATGTGATTAAAAATGCAATACTTGCTTAGGAAGTCCTACTTTTTGTACATCTTG
TAATGGGGATTATTATTATTTAGAAAAATAAAATGACTGTTTAAAGGATAAATGTCCTGA
TGGAATGTTTAAATACAAAGACGCTTCCAAAGGGCTTAATTTTTGCCAGAAATGTCACAT
GAATTGCTTAACTTGTTTCGCTGGAGATATAGATAATTGTTTAAGTTGTGATCCTGCTGT
TGGGTTTTTGAAAGGGAATGTTTGTGCTGCATGTAATTCAAATTAATATGGAGACACAAA
AGATTAAACATGTAAGCCTTGTAACTTAAATTGTACAACTTGTGAAGGGCCTAATGACGA
TTAGTGCAGGAGTTGCTCTGGATCGTTATTTTTAAAAGATAAAAAATGTAATCCGACATG
TCCAGATTAAACTTATCCAGATATTTCAACTCATGAATGCGCTCCTTGTGATAGTACTTG
TTATAAATGTTCATCTGCTGGTCCAAATAGTTGCAAATCATGTCCTTCTGGTAGATTTTT
GAAAGGAACTGTTTGTTAAACAACTTGCGATATAGTTGGAGAATATCCTGACACTACCAA
CAAGTTGATAAAATTATTTTAAATTTAAATCTTTTTACTTATTTTTAAATAAATTTTTTA
ACAGCGTTTGTGGTACTTGTAATTCAGAATGCTTAAAATGTAAGGATGGTACAAAATTAG
GTTGCATAGAGTGTTCTTCAAGTAAATATTTACAGGTAAACTAGTGTGTTGACAGTTGTC
TTTCTAATTTGTTTGGGTTAGAGGAAACAAAGTAATGCTTAGAAGAGTGCCCTTAAGGAT
ATTATGGTGATTCAGTTAGCAAAAAATGTCTTAAATGTGAAGCATTTTGCCCTATTTGCA
AAGCATCAGGTTTTAGTAATTGTGAGAAATGTGCTGGAGATTTATTCTTATAAGATAGTT
AATGCCTAAAATAGTGCAAAGATGGTTTTTATGCAGATAAAACTGACAATATTTGCAAAA
AATGTCACGATAGTAAAATTTTAAAAATATTTTTCAATTTATGAACTTTATCAAAAAATA
AAAGACTGTCTAGAATGCTAAGCTGGTACTGAAAATGACTGCACAAAGTGTAAGAGTAAG
CAGTTTTTAGGATAAAATACATGTTATACTAAATGTCCTAACAAATAATATGGAAATTAA
GTTAATATGAACTGTGTTTAGGAATGTCCTCTTGGAACTTATGGAAATTAATATGAAAAT
TTATGTAGAGCTTGTCATAGTAACTGCTCTCAGTGTTATGGTTCTTCTTATTCTTAATGC
TACAAGTGCAATTTAGGACACTACTTGCTTGATAGTACTTGTGATTTATGTCCATCTGGA
TATTACAAAAATGATCAATAAAGAACTTGTGATCCATGCTTTGATAAGTAAATAAGTAAT
TAAATTATTTAAATTTTATAATTTCTTTTGTTTTTAAGCTGTACTTAATGTGATGGAGGA
TCTCCCTCAGATTGCTTGAAATGTGCCTATGGCTATTACCATTTAAAAGAATAAAAAATG
TGTGTATCAACATGTCCTGACCCTTACTACTCAGAAGAAAATAATCCTGATTGCATTCTT
TCTTGTACTCAGTCTAATTAATATCCCAATAATATTACTAGAAAATGTGAAAATTGCAAT
ATTGCTTGCAAAGAATGTTTTGGATCAGATGAGTCCAGCTGCAAGAAATGTTCAACAAAC
TACCTATTTTTAGAAAAAAGTAATTAATATTTTATTTTTTTTAATTTTTCAAAAATAAAA
ATTGTTTGGTTTAAAATTATAAAAAAAATTTAAAAAATATAAAAACAAACTTTATTTAAA
TAAATTATTTTTTCAAAACAATAATTTTTCTTTCATTAAAATGATTGATTTTTTGAATTA
AATTGTATAAAAATTAAGAGTAAAATATGATTTAAAGATAATTTTTAGAGTAAAATTGAA
GTTATTTTATTTAATTTAAAAAATTAAGCATTTAAATAAATATTTAATTTATAATAAAAC
CTAAAAAATTAAAGGAATTTTTTGCTTTAAATTTTATAAAAAAAAATTTTAAATATTTAA
ATTTATATTTATTATTAAACTTACATGAAAATTTAAAGAATTCTTTCAAAATTATTAAAA
TTAATTAATTATTTACTCAGGCTTATTCATTAAATTAAATACTTAGGAAATATGTGCACA
AAAAAATGTCCTTATGGATATTATGAAAATTATATAACTTTTACCTGTGATCCTTGTGAT
AAAACGTGTTAAACTTGCTATGGTGGATCCCCAGATTAGTGTATTTCATGCAGAGAACCT
AATTTCTTATTTTAAAATTATTGCACTGATACTTGTCCTCAAAATTTATATAAAGACCTT
GAAATATTAAAATGTGTTGAAGATTGCACACAATACAAATCAAATAGATTTGCAAATTAA
TTAACAAGAAATTGCTAGTTTTGCCATTCATCATGCCAAAAATGTACAGGACCAACCAAT
AAGGAGTGCACTTAATGCACTTCTTCTCACCTTCTTCTTGGAACTAGTTGCTTAGATACT
TGTCCATTAGGATATTACGCTGTCTATAAAGACCCAAATTTAAAGAATTCAGATTAAATT
AAAGTAACTGATGATTGTTAAAAATGTCATTAAAATTGCGAGGACTGTTATGGACCGTCT
GAGAGTGAGTGTAGAACATGCTCAAAAGGTCTTTATACTTATCATGCTCCCTCAATAGAA
AATTAAGGAATTGAAAAGAAAACTTGTGTTGCCCAATGTCCAGACCAATATATAGTAAAT
CACTAAAATATGTCTTGCGAATTATGTCCACCTTACACTTTTTTCGAAAATGGAGTTTGC
AAAAGTAAAATTTTATTTATTTATTTATTTTTGTTTATATTTCTTTAACTTTACATTTAA
AAGATTGTCATTATTCTTGCATTAAGTGCAAAGGACAAACCTAATTTGATTGCATTAAAT
GCACTTCTGAAAGATCAATTTATAATGAAGGTGAACCTTTAAATGGATAGTGCAACTGCA
AATAAGGTTATATGGAAACATTTTCTCATGAATGCTCATAGCTTCCTATTATAGCTACGT
CTATGAGTAAGTCTATTTTTGTTTCTCTTTTGACTTCTTTATCTTGCTCTATCATTACTG
GATTACTCAGCACCTCTGCATTTTCTTTCCATCAATTAATAGAAGCTTCATATTACACTG
GTTATCTTAAATTTGCTAATGTTACTTATCCTTTAAACTTACATTATTTATTTGAGAGTG
TTTCCACAGATTAAAGCAATCAAATCTTCGAAAATAAAAGTTAAACTTCCACATAAATAA
AAGACAAAGTAATTTTAATATTTGATAAAAATTAAGAGTTTTTATTAATTTTTTACTTTT
AATCTAGTCAAGAATTTTAATAAGTAAGACAGAGTTGTTGCAATCTTAAGAAGTTGGAGA
AGCTCCTTAGGTGTGGAAAAAATTCATATTCACTTTAGTTATAAATATATCTTCTTGGTT
TATTGTGCTCATACTCAATTTAGCAGTAATTCATATGAAAGTAAAGTATAATTAGCAAAA
TAAATTAGAAAAAGTAAGGGTACTACTGTAGTATACTCTTCCAATTTAAGCTTTTTTAAG
GACATCACAAGAGGCATTTTAGTTTATCTTTCTCAGTGCCTATTTTAGTGCAACTTTGGA
TGTGTTTGGATGGCTAAATTTTGTATACATATTAATTACTATGCTTGTAGTATTTGGGAT
TATAATCAAATTATCTTTCCTATAACTTAATGAAAAAAAATCAGATACTTCAGATAAAGG
AGCTGGAGAATATTTTATAAGGGTGAAAGTAAAAAAAAATAAAACTATAGATTATCCCCA
TCCTCTGAGAACGCTTTTATATTTTTTTAAAGACAATAAATTTGCTAGAAATTATTACAC
CTTAATGCTACTTTTCAAATTTTCAAATGTGTTTGTAATTGTTTTTACTAGCAATATTGT
GATTTAAATGGTAATTATGATCATAACAAAATTACTTTTTGTTATTTACTTGATTATTTG
CAAGCCATTTAAATAAAAAAATTATAATTACATCAATATTTTTAATGAAATCCTCTCTTG
CTCTATTCCTTTAACTATTTTAATCATGGCTAAATCTGAAGAAAATGAAGCTAACTATAA
TGCTTTTGGCTGGTTAATATTTGTTGAAATGATCATTCTATTTTTGTTTAACTTTATATA
TGCAGTTTTTGAACTTGTAATGATGCTAAAGATTTATATAACCAAAAAACTTAAATTCTC
AAAAAGATTTATAAAAATAAACTCAGAAAAATAATCAGATTCTGCTGATTAATCAGCTGA
TAACCAGTCTGTTTTGTTTGAAAAAAATGTTTTAAAAAATATTTAAAATGTCCCACTGAG
GATAGAAGAAAAAAATGATTTTGATAAGTAAAACTCGCCTGTGAAATAACATACGAAGAA
TAATCACTTGAAAGTATTGCAAATTGGCTAAACAAATTAGAATCTACAGTCAAGTTGCTA
ATCAATAGAAGGTCCTTCAATCCAAGCTACAGGTACAAGAAAAAACATTGTTCATCCAGA
ATGTACAATAGAGATTGATAAATCCTAGTTAGAAAACTAAAATCAATCTTCAGTTTCTAA
GTCATACAATTAATAAGAAGGCGATGAAGAAGATTTCAATCTAAATTCATCAAATGTCAA
AGCATAGTCTATCCTTAAAGAAGATTATGAGTATGATGAAAACAGTGAAAACATGGGATT
CCCACTTTCAATTTATGGTAAATAGCTGGAATAAAATCAAGCAAAATCACCTTTGAAAAG
AAAAAAAAGAAATAAAAAAAAAGATGAATAAAAAGTATAATTTGCTTAGGAATAAGAAGA
CATAACAAACAAAAAGTCTTTGGAGAATCAGACTAATTCGGCAGAAGTTAGCTCTTAAAA
TAATACAGTAAAATCTAAGTAAGAGGAAGAAGATGAATAGAAGTAGCAGCATATATCTTA
AGTTATAGAGAATGTTAATGATAAGTTATTAAAAAGCAACAATGGAAATATTCAACCAAA
AAATATTACTGAAAGAACTTCACTTGATCTAATTAAGGTGATTGAGTAAGAATCTAATTC
TTGGGGATTAAAGAAAAAACTATCAATAAAATAAAAGCTTTAAAAAATGTAATAAAATCC
TTAAAAAGAAGTTATTGAGGATATTGATGAATCTAATGGAGAAAAAGTTATCACATAAGT
TATTACTAAGTAAAAGAGTGATAGAAGTAGAACAAGTGATATAGTTTTAAATTCAAGTAA
AAGGTAAAAGGAAGATAATTCTTTGAAAATAATAGAATTAAATTAGGACTAGAAATCTAA
TTAAGCTCAGCAATAATAACAAATTTTTGAAGAAAATGAGATCAAAATTAATTCATAAAA
ATAAATTTAAAACTAAAACAAAAATTAAAAAAATTAAAATATTAAAAACTCAAGTTTGAA
AGATTCAAAATCTAGTAAATTAAATAATGACAGTAAAATATCAAATGAAAATAAAAAAGA
CAATATAGTTTTTAGAAATGAAGGATTATTTGGAGGCATAAGCGAGTTTAAAATAAAAAG
GGTTGTTTAATCTTAAAGTACTAACACTAGTCCTTTGAAAAAAGTAGATTCTAGACTCAA
AGAAGATAAAGAAGATGAATCTAAGTCAATACTAGATTTTATTAAACAGAAAGTTATCAA
ATAAAACTTGTTTAAAGAATCAAAATGA