Identifiers and Description

Gene Model Identifier

TTHERM_00070770

Standard Name

None

Aliases

PreTt13267 | 4.m00666 | 3707.m00301

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00070770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02178.19.997093137033517e-262hypothetical protein (326 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00070770(coding)
ATGAGTTTTACTACAAGTTTTTCTGACATTTTTGATAATCAAAAAGGTGTTTTGCAAACT
GGTTATGTCCACAATAACTTTTCAACCTTCTCATTTACTAATTAAATATAGAATTAGTTT
AAATTAAAGGCTAAGGTTTATTAGCGCATCGAAAACAATGGAACAACTTCTGTTCATAAT
AACGGTTTGCTTGAGCTTGATTATAAAAATGATGAGTGGAGATTTTCAAAAAAAATTGAT
GTAAATAGAAATATATCTATGAGAATTGATAAGCTCCTTTAACAAGAATTTGTGAAAGGA
CATACAATTTTTGGTAAATTTGATAAAGATTCTGACTCCTAAACTGAATCATAGCACAAT
CCCTGCATAGGTGTTTATAAAAATTTTGATAAATATGCATACAAGGCAAAATTTAATATA
GAAACATTAGTTGCATAACTTAAGGGTAAAGCAGTCTATGATAAGCATAGCAGTGAAGAT
AAAGAGTAATATGGTACTGGAGTTTCAGCAAGCTTTGATTTCAAATAAAACTTATTTTCT
AATGCCAAGACTTTAGTCTATTACAATAGCTTGAATACATCAATGAATATGCAATACTAA
ATGAAAAGATTATAAAGGGTCGATGACCATGAAGCTTCAAGCAGTTAAGGAGGAGAAATC
TACTATACATTCTTGTATTCACTTTACTAAAAGTTAAATGATCATTTAAGTATTGCAGTT
GAACTTAATCATGATTCTAATGAGAAAAAATTCGGAATGGTATTTGGTGGAAAATATACA
AAATTTGATAATGTAATTTGCCGTGCTAAAATCGATGATAAATTTATCGTTAATTCCTCC
TTCGAAATAGACATCAACAAAAATATTAAATTCACAATATCAAATATGATTGATTTGAGT
CTAAGAAACAAAAAAGATGCAACAACTACTTCTTCTCATTATAGCTTCCCTATCGGTTTC
TAACTTGATATCTAATAGTGA


>TTHERM_00070770(protein)
MSFTTSFSDIFDNQKGVLQTGYVHNNFSTFSFTNQIQNQFKLKAKVYQRIENNGTTSVHN
NGLLELDYKNDEWRFSKKIDVNRNISMRIDKLLQQEFVKGHTIFGKFDKDSDSQTESQHN
PCIGVYKNFDKYAYKAKFNIETLVAQLKGKAVYDKHSSEDKEQYGTGVSASFDFKQNLFS
NAKTLVYYNSLNTSMNMQYQMKRLQRVDDHEASSSQGGEIYYTFLYSLYQKLNDHLSIAV
ELNHDSNEKKFGMVFGGKYTKFDNVICRAKIDDKFIVNSSFEIDINKNIKFTISNMIDLS
LRNKKDATTTSSHYSFPIGFQLDIQQ


>TTHERM_00070770(gene)
ATGAGTTTTACTACAAGTTTTTCTGACATTTTTGATAATCAAAAAGGTATCTGATAATAA
AAATAGTATCCTATTTAGCTTAAGAGAAATTAAATATATATTAATAGGTGTTTTGCAAAC
TGGTTATGTCCACAATAACTTTTCAACCTTCTCATTTACTAATTAAATATAGAATTAGTT
TGTAATAAGTTGCAATCATACATTTAAGAACGAAAAAATAAATGACACAGAGATATAATA
ATTATTTTTTCAGTAATCATAACTTTTATCATTGATCGATGAAAAAATAAGCATTATTCA
ATCTCTTGTTATAATTCTAAAACTTTTTATTAATCCATTTTAATTTTTTTTAAATTTTAT
GAGAGTAGAAATTAAAGGCTAAGGTTTATTAGCGCATCGAAAACAATGGAACAACTTCTG
TTCATAATAACGGTTTGCTTGAGCTTGATTATAAAAATGATGAGTGGAGATTTTCAAAAA
AAATTGATGTAAATAGAAATATATCTATGAGAATTGATAAGCTCCTTTAACAAGTAATTG
ATAAAATAATTAGTTTATTATTTCTTTCCATAGAATTTTCAGCAGAATTACAATAGAAGT
GTATGCTTGCTTAGCATAAAGCTCAAATCTCCTTTGAATTAATAATAAAGCTAATTTCAA
AATATTAAAAATTTTTAAAATAAAGGAATTTGTGAAAGGACATACAATTTTTGGTAAATT
TGATAAAGATTCTGACTCCTAAACTGAATCATAGCACAATCCCTGCATAGGTGTTTATAA
AAATTTTGATAAATATGCATACAAGGTAAAAAATAATTAAATTACTTATTTATTAAACTT
GCACTTACTTAATAAAATGTAGCATTTAGAAATTAATAAATTATAAGTATAAAGCTAATA
TTTAAATCTACTGTATTTTCAGTGATAATCGTTTTAAGTTTAAAAATTAATTAGGATAAA
AATAAAATGTTAAATAAATTAAAGGTTTTACATTTCCAAGATAATTTATCTAACTTCTAT
ATTGAAAGTTTATATTTATACTATATTTATTAATTTTTAAACTAAAAAATTAGGCAAAAT
TTAATATAGAAACATTAGTTGCATAACTTAAGGGTAAAGCAGTCTATGATAAGCATAGCA
GTGAAGATAAAGAGTAATATGGTACTGGAGTTTCAGCAAGCTTTGATTTCAAATAAAACT
TATTTTCTAATGCCAAGACTTTAGTCTATTACAATAGCTTGAATACATCAATGAATATGC
AATAGTAATAAAAAATTACTCTAATTTAATTTTTCATTGTACTAGTAGCCTTTTTTTTAA
AAAATTGATTAATAATAATATTTAAATTGAATAAGTGTAAATTAATTACTAAAGCAACTT
TTTAACTTTACTTTTATTTTAGCTAAATGAAAAGATTATAAAGGGTCGATGACCATGAAG
CTTCAAGCAGTTAAGGAGGAGAAATCTACTATACATTCTTGTATTCACTTTACTAAAAGT
TAAATGATCATTTAAGTATTGCAGTTGAACTTAATCATGATTCTAATGAGAAAAAATTCG
GAATGGTATTTGGTGGAAAATATACAAAATTTGATAATGTAATTTGCCGTGCTAAAATCG
ATGATAAATTTATCGTTAATTCCTCCTTCGAAATAGACATCAACAAAAATATTAAATTCA
CAATATCAAATATGGTAAAATACCCACATACATTTTCTTTTAATTTAATAAATTTAGTAA
GTTAAATGGCAATATATGGTGCATTATAAATTTAGATTAAAGGCTGATTTATGTTTCTAG
AAAAGAGCTCTAACCAAAAAATAACTTAAATAAGTTTTATAAAGAGTTTTAAGCCATAAA
TTATTATTTTAAATGTGTAATTTACAGCTAATAAAATATAATTGAGATTAGCTTAAAATA
TTACCCGAAAATATTAATCTATAATATTCAATTTAAAAAGATCACCACACCATCAATAAA
ATAACTTTATTAAAATAATTCAAAAATATTTAGATTGATTTGAGTCTAAGAAACAAAAAA
GATGCAACAACTACTTCTTCTCATTATAGCTTCCCTATCGGTTTCTAACTTGATATCTAA
TAGTGA