Identifiers and Description

Gene Model Identifier

TTHERM_00070740

Standard Name

None

Aliases

PreTt13264 | 4.m00663 | 3707.m00298

Description

Nucleotide-binding oligomerization domain-containing protein 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00070740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02176.12.9990203769197855e-115hypothetical protein (166 aa)
OxytrichaContig21113.0.g832.0002795641672355e-21Herpesvirus glycoprotein U47

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00070740(coding)
ATGAAATCTAAAGCTAATAGATAAGGAACTGGAATGAACGAAGTTCATAAAAATATAGTC
CACACTGAAACTATAACAAAGGAAATGAAATTTTGCGATAAAAATTAAATGGAACATTTC
CAACTCAACCCTCATAACATGTTTATACTTGCTGAAAAGCCTAATTATGTAATTCCTCAA
GACTTCAAGAGATAAAAGGGTATATAAAATTAAAAAAAGTCAGATGCAAATGAGATTTTC
GGTAATCATTTTACCGAAGATCCTGTAGAGGAAGCTTTCTCAAATGAAAAACTAGATAAA
ACATTAAAAACAGTTACTTTGGTTCCAAGGTAAAAGTATGATTTACCTTAAACAAGAAAC
CAAGAAATAGGATGGTTCACAAATTAACTGCATGTTTAAAAACCTACTAAAAACCACTCA
ATCTAAAAATGCGAAATTACTAAATTCGTAGATGACTACTACGAGATGACTAAAATAAAT
CCTTTCAAATTAAGATGA


>TTHERM_00070740(protein)
MKSKANRQGTGMNEVHKNIVHTETITKEMKFCDKNQMEHFQLNPHNMFILAEKPNYVIPQ
DFKRQKGIQNQKKSDANEIFGNHFTEDPVEEAFSNEKLDKTLKTVTLVPRQKYDLPQTRN
QEIGWFTNQLHVQKPTKNHSIQKCEITKFVDDYYEMTKINPFKLR


>TTHERM_00070740(gene)
ATGAAATCTAAAGCTAATAGATAAGGAACTGGAATGAACGAAGTTCATAAAAATATAGTC
CACACTGAAACTATAACAAAGGAAATGAAATTTTGCGATAAAAATTAAATGGAACATTTC
CAACTCAACCCTCATAACAGTAAAAATTTATTTTGAAATATTTTATTTAAAAGACTTTAA
TGTTTTAAATTAAAATAGTGTTTATACTTGCTGAAAAGCCTAATTATGTAATTCCTCAAG
ACTTCAAGAGATAAAAGGGTATATAAAATTAAAAAAAGTCAGATGCAAATGAGATTTTCG
GTAATCATTTTACCGAAGATCCTGTAGAGGAAGCTTTCTCAAATGAAAAACTAGATAAAA
CATTAAAAACAGTTACTTTGGTTCCAAGGTAAAAGTATGATTTACCTTAAACAAGAAACC
AAGAAATAGGATGGTTCACAAATTAACTGGTATACATTCCTTACTAAAATAAAATCCCAT
TTTAAATCAATTTTTTATTAAAAATTTATAAAGCATGTTTAAAAACCTACTAAAAACCAC
TCAATCTAAAAATGCGAAATTACTAAATTCGTAGATGACTACTACGAGATGACTAAAATA
AATCCTTTCAAATTAAGATGA